Interleukin-1 beta

Details

Name
Interleukin-1 beta
Kind
protein
Synonyms
  • Catabolin
  • IL-1 beta
  • IL1F2
Gene Name
IL1B
UniProtKB Entry
P01584Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0010736|Interleukin-1 beta
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Number of residues
269
Molecular Weight
30747.7
Theoretical pI
4.45
GO Classification
Functions
integrin binding
Processes
astrocyte activation / cellular response to interleukin-17 / cellular response to lipopolysaccharide / cellular response to xenobiotic stimulus / defense response to Gram-positive bacterium / immune response / interleukin-1-mediated signaling pathway / JNK cascade / negative regulation of cell population proliferation / negative regulation of gap junction assembly / negative regulation of glucose transmembrane transport / negative regulation of neurogenesis / negative regulation of synaptic transmission / positive regulation of canonical NF-kappaB signal transduction / positive regulation of cell division / positive regulation of cell migration / positive regulation of cell population proliferation / positive regulation of complement activation / positive regulation of DNA-binding transcription factor activity / positive regulation of DNA-templated transcription / positive regulation of epithelial to mesenchymal transition / positive regulation of glial cell proliferation / positive regulation of inflammatory response / positive regulation of interleukin-2 production / positive regulation of MAP kinase activity / positive regulation of neuroinflammatory response / positive regulation of non-canonical NF-kappaB signal transduction / positive regulation of p38MAPK cascade / positive regulation of prostaglandin biosynthetic process / positive regulation of RNA biosynthetic process / positive regulation of T-helper 1 cell cytokine production / positive regulation of transcription by RNA polymerase II / positive regulation of type II interferon production / regulation of canonical NF-kappaB signal transduction / regulation of defense response to virus by host / regulation of ERK1 and ERK2 cascade / regulation of neurogenesis / regulation of nitric-oxide synthase activity / response to carbohydrate / response to interleukin-1 / response to lipopolysaccharide / vascular endothelial growth factor production
General Function
Potent pro-inflammatory cytokine (PubMed:10653850, PubMed:12794819, PubMed:28331908, PubMed:3920526). Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production (PubMed:3920526). Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells (PubMed:10653850). Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6 (PubMed:12794819). Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore (PubMed:33377178, PubMed:33883744). Acts as a sensor of S.pyogenes infection in skin: cleaved and activated by pyogenes SpeB protease, leading to an inflammatory response that prevents bacterial growth during invasive skin infection (PubMed:28331908)
Specific Function
cytokine activity
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm, cytosol
Gene sequence
>lcl|BSEQ0010737|Interleukin-1 beta (IL1B)
ATGGCAGAAGTACCTGAGCTCGCCAGTGAAATGATGGCTTATTACAGTGGCAATGAGGAT
GACTTGTTCTTTGAAGCTGATGGCCCTAAACAGATGAAGTGCTCCTTCCAGGACCTGGAC
CTCTGCCCTCTGGATGGCGGCATCCAGCTACGAATCTCCGACCACCACTACAGCAAGGGC
TTCAGGCAGGCCGCGTCAGTTGTTGTGGCCATGGACAAGCTGAGGAAGATGCTGGTTCCC
TGCCCACAGACCTTCCAGGAGAATGACCTGAGCACCTTCTTTCCCTTCATCTTTGAAGAA
GAACCTATCTTCTTCGACACATGGGATAACGAGGCTTATGTGCACGATGCACCTGTACGA
TCACTGAACTGCACGCTCCGGGACTCACAGCAAAAAAGCTTGGTGATGTCTGGTCCATAT
GAACTGAAAGCTCTCCACCTCCAGGGACAGGATATGGAGCAACAAGTGGTGTTCTCCATG
TCCTTTGTACAAGGAGAAGAAAGTAATGACAAAATACCTGTGGCCTTGGGCCTCAAGGAA
AAGAATCTGTACCTGTCCTGCGTGTTGAAAGATGATAAGCCCACTCTACAGCTGGAGAGT
GTAGATCCCAAAAATTACCCAAAGAAGAAGATGGAAAAGCGATTTGTCTTCAACAAGATA
GAAATCAATAACAAGCTGGAATTTGAGTCTGCCCAGTTCCCCAACTGGTACATCAGCACC
TCTCAAGCAGAAAACATGCCCGTCTTCCTGGGAGGGACCAAAGGCGGCCAGGATATAACT
GACTTCACCATGCAATTTGTGTCTTCCTAA
Chromosome Location
2
Locus
2q14.1
External Identifiers
ResourceLink
UniProtKB IDP01584
UniProtKB Entry NameIL1B_HUMAN
GenBank Protein ID307043
GenBank Gene IDK02770
GeneCard IDIL1B
GenAtlas IDIL1B
HGNC IDHGNC:5992
PDB ID(s)1HIB, 1I1B, 1IOB, 1ITB, 1L2H, 1S0L, 1T4Q, 1TOO, 1TP0, 1TWE, 1TWM, 21BI, 2I1B, 2KH2, 2NVH, 31BI, 3LTQ, 3O4O, 3POK, 41BI, 4DEP, 4G6J, 4G6M, 4GAF, 4GAI, 4I1B, 5BVP, 5I1B, 5MVZ, 5R7W, 5R85, 5R86, 5R87, 5R88, 5R89, 5R8A, 5R8B, 5R8C, 5R8D, 5R8E, 5R8F, 5R8G, 5R8H, 5R8I, 5R8J, 5R8K, 5R8L, 5R8M, 5R8N, 5R8O, 5R8P, 5R8Q, 6I1B, 6Y8I, 6Y8M, 7CHY, 7CHZ, 7I1B, 7Z4T, 8C3U, 8RYK, 8RYS, 8RZB, 9ILB
KEGG IDhsa:3553
NCBI Gene ID3553
General References
  1. Auron PE, Webb AC, Rosenwasser LJ, Mucci SF, Rich A, Wolff SM, Dinarello CA: Nucleotide sequence of human monocyte interleukin 1 precursor cDNA. Proc Natl Acad Sci U S A. 1984 Dec;81(24):7907-11. [Article]
  2. March CJ, Mosley B, Larsen A, Cerretti DP, Braedt G, Price V, Gillis S, Henney CS, Kronheim SR, Grabstein K, et al.: Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs. Nature. 1985 Jun 20-26;315(6021):641-7. [Article]
  3. Clark BD, Collins KL, Gandy MS, Webb AC, Auron PE: Genomic sequence for human prointerleukin 1 beta: possible evolution from a reverse transcribed prointerleukin 1 alpha gene. Nucleic Acids Res. 1986 Oct 24;14(20):7897-914. [Article]
  4. Nishida T, Nishino N, Takano M, Kawai K, Bando K, Masui Y, Nakai S, Hirai Y: cDNA cloning of IL-1 alpha and IL-1 beta from mRNA of U937 cell line. Biochem Biophys Res Commun. 1987 Feb 27;143(1):345-52. [Article]
  5. Bensi G, Raugei G, Palla E, Carinci V, Tornese Buonamassa D, Melli M: Human interleukin-1 beta gene. Gene. 1987;52(1):95-101. [Article]
  6. Kotenko SV, Bulenkov MT, Veiko VP, Epishin SM, Lomakin IB: [Cloning of the cDNA coding for human prointerleukin-1 alpha and prointerleukin-1 beta]. Dokl Akad Nauk SSSR. 1989;309(4):1005-8. [Article]
  7. Nicklin MJ, Barton JL, Nguyen M, FitzGerald MG, Duff GW, Kornman K: A sequence-based map of the nine genes of the human interleukin-1 cluster. Genomics. 2002 May;79(5):718-25. [Article]
  8. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  10. Mizutani H, Schechter N, Lazarus G, Black RA, Kupper TS: Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase. J Exp Med. 1991 Oct 1;174(4):821-5. [Article]
  11. Van Damme J, De Ley M, Opdenakker G, Billiau A, De Somer P, Van Beeumen J: Homogeneous interferon-inducing 22K factor is related to endogenous pyrogen and interleukin-1. Nature. 1985 Mar 21-27;314(6008):266-8. [Article]
  12. Zsebo KM, Wypych J, Yuschenkoff VN, Lu H, Hunt P, Dukes PP, Langley KE: Effects of hematopoietin-1 and interleukin 1 activities on early hematopoietic cells of the bone marrow. Blood. 1988 Apr;71(4):962-8. [Article]
  13. Nanduri VB, Hulmes JD, Pan YC, Kilian PL, Stern AS: The role of arginine residues in interleukin 1 receptor binding. Biochim Biophys Acta. 1991 Dec 11;1118(1):25-35. [Article]
  14. MacKenzie A, Wilson HL, Kiss-Toth E, Dower SK, North RA, Surprenant A: Rapid secretion of interleukin-1beta by microvesicle shedding. Immunity. 2001 Nov;15(5):825-35. [Article]
  15. Andrei C, Margiocco P, Poggi A, Lotti LV, Torrisi MR, Rubartelli A: Phospholipases C and A2 control lysosome-mediated IL-1 beta secretion: Implications for inflammatory processes. Proc Natl Acad Sci U S A. 2004 Jun 29;101(26):9745-50. Epub 2004 Jun 10. [Article]
  16. Papin S, Cuenin S, Agostini L, Martinon F, Werner S, Beer HD, Grutter C, Grutter M, Tschopp J: The SPRY domain of Pyrin, mutated in familial Mediterranean fever patients, interacts with inflammasome components and inhibits proIL-1beta processing. Cell Death Differ. 2007 Aug;14(8):1457-66. Epub 2007 Apr 13. [Article]
  17. Piccioli P, Rubartelli A: The secretion of IL-1beta and options for release. Semin Immunol. 2013 Dec 15;25(6):425-9. doi: 10.1016/j.smim.2013.10.007. Epub 2013 Nov 5. [Article]
  18. Baroja-Mazo A, Martin-Sanchez F, Gomez AI, Martinez CM, Amores-Iniesta J, Compan V, Barbera-Cremades M, Yague J, Ruiz-Ortiz E, Anton J, Bujan S, Couillin I, Brough D, Arostegui JI, Pelegrin P: The NLRP3 inflammasome is released as a particulate danger signal that amplifies the inflammatory response. Nat Immunol. 2014 Aug;15(8):738-48. doi: 10.1038/ni.2919. Epub 2014 Jun 22. [Article]
  19. Priestle JP, Schar HP, Grutter MG: Crystal structure of the cytokine interleukin-1 beta. EMBO J. 1988 Feb;7(2):339-43. [Article]
  20. Finzel BC, Clancy LL, Holland DR, Muchmore SW, Watenpaugh KD, Einspahr HM: Crystal structure of recombinant human interleukin-1 beta at 2.0 A resolution. J Mol Biol. 1989 Oct 20;209(4):779-91. [Article]
  21. Priestle JP, Schar HP, Grutter MG: Crystallographic refinement of interleukin 1 beta at 2.0 A resolution. Proc Natl Acad Sci U S A. 1989 Dec;86(24):9667-71. [Article]
  22. Driscoll PC, Gronenborn AM, Wingfield PT, Clore GM: Determination of the secondary structure and molecular topology of interleukin-1 beta by use of two- and three-dimensional heteronuclear 15N-1H NMR spectroscopy. Biochemistry. 1990 May 15;29(19):4668-82. [Article]
  23. Clore GM, Wingfield PT, Gronenborn AM: High-resolution three-dimensional structure of interleukin 1 beta in solution by three- and four-dimensional nuclear magnetic resonance spectroscopy. Biochemistry. 1991 Mar 5;30(9):2315-23. [Article]
  24. Vigers GP, Anderson LJ, Caffes P, Brandhuber BJ: Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta. Nature. 1997 Mar 13;386(6621):190-4. [Article]
  25. Wang D, Zhang S, Li L, Liu X, Mei K, Wang X: Structural insights into the assembly and activation of IL-1beta with its receptors. Nat Immunol. 2010 Oct;11(10):905-11. doi: 10.1038/ni.1925. Epub 2010 Aug 29. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Minocyclineapproved, investigationalunknowntargetmodulatorDetails
TalmapimodinvestigationalunknowntargetDetails
Etiprednol dicloacetateinvestigationalunknowntargetDetails
VP025investigationalunknowntargetDetails
VX-702investigationalunknowntargetDetails
AndrographolideinvestigationalunknowntargetDetails
VX-765investigationalunknowntargetDetails
GevokizumabinvestigationalunknowntargetDetails
Canakinumabapproved, investigationalyestargetbinderantibodyDetails
Rilonaceptapproved, investigationalyestargetbinderDetails
DilmapimodinvestigationalunknowntargetDetails
Foreskin keratinocyte (neonatal)approvedyestargetagonistDetails
DonepezilapprovedunknowntargetinhibitorinducerDetails
CelastrolinvestigationalyestargetsuppressorDetails
TT-301investigationalyestargetinhibitorDetails
Gallium nitrateapproved, investigationalyestargetinhibitorDetails
Glucosamineapproved, investigationalyestargetinhibitorDetails
Diacereinapproved, investigationalyestargetinhibitorDetails