Protein S100-B

Details

Name
Protein S100-B
Kind
protein
Synonyms
  • S-100 protein beta chain
  • S-100 protein subunit beta
  • S100 calcium-binding protein B
Gene Name
S100B
UniProtKB Entry
P04271Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0010821|Protein S100-B
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Number of residues
92
Molecular Weight
10712.985
Theoretical pI
4.25
GO Classification
Processes
adaptive thermogenesis / cell adhesion / positive regulation of canonical NF-kappaB signal transduction / positive regulation of cell population proliferation / positive regulation of neuron differentiation / sympathetic neuron projection extension
Components
cytosol / nucleoplasm
General Function
Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed:20950652, PubMed:6487634). Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer (PubMed:20950652, PubMed:6487634). Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites (By similarity). Acts as a neurotrophic factor that promotes astrocytosis and axonal proliferation (By similarity). Involved in innervation of thermogenic adipose tissue by acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation of adipose tissue (By similarity). Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase (By similarity). Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization (PubMed:20351179). May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (PubMed:22399290)
Specific Function
calcium ion binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010822|Protein S100-B (S100B)
ATGTCTGAGCTGGAGAAGGCCATGGTGGCCCTCATCGACGTTTTCCACCAATATTCTGGA
AGGGAGGGAGACAAGCACAAGCTGAAGAAATCCGAACTGAAGGAGCTCATCAACAATGAG
CTTTCCCATTTCTTAGAGGAAATCAAAGAGCAGGAGGTTGTGGACAAAGTCATGGAAACA
CTGGACAATGATGGAGACGGCGAATGTGACTTCCAGGAATTCATGGCCTTTGTTGCCATG
GTTACTACTGCCTGCCACGAGTTCTTTGAACATGAGTGA
Chromosome Location
21
Locus
21q22.3
External Identifiers
ResourceLink
UniProtKB IDP04271
UniProtKB Entry NameS100B_HUMAN
GenBank Protein ID337730
GenBank Gene IDM59488
GeneCard IDS100B
GenAtlas IDS100B
HGNC IDHGNC:10500
PDB ID(s)1MQ1, 1UWO, 2H61, 2M49, 2PRU, 3CZT, 3D0Y, 3D10, 3HCM, 4XYN, 5CSF, 5CSI, 5CSJ, 5CSN, 5D7F
KEGG IDhsa:6285
NCBI Gene ID6285
General References
  1. Allore RJ, Friend WC, O'Hanlon D, Neilson KM, Baumal R, Dunn RJ, Marks A: Cloning and expression of the human S100 beta gene. J Biol Chem. 1990 Sep 15;265(26):15537-43. [Article]
  2. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Jensen R, Marshak DR, Anderson C, Lukas TJ, Watterson DM: Characterization of human brain S100 protein fraction: amino acid sequence of S100 beta. J Neurochem. 1985 Sep;45(3):700-5. [Article]
  5. Baudier J, Glasser N, Haglid K, Gerard D: Purification, characterization and ion binding properties of human brain S100b protein. Biochim Biophys Acta. 1984 Oct 23;790(2):164-73. [Article]
  6. Yang Q, O'Hanlon D, Heizmann CW, Marks A: Demonstration of heterodimer formation between S100B and S100A6 in the yeast two-hybrid system and human melanoma. Exp Cell Res. 1999 Feb 1;246(2):501-9. [Article]
  7. Park H, Adsit FG, Boyington JC: The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding. J Biol Chem. 2010 Dec 24;285(52):40762-70. doi: 10.1074/jbc.M110.169276. Epub 2010 Oct 13. [Article]
  8. Gilquin B, Cannon BR, Hubstenberger A, Moulouel B, Falk E, Merle N, Assard N, Kieffer S, Rousseau D, Wilder PT, Weber DJ, Baudier J: The calcium-dependent interaction between S100B and the mitochondrial AAA ATPase ATAD3A and the role of this complex in the cytoplasmic processing of ATAD3A. Mol Cell Biol. 2010 Jun;30(11):2724-36. doi: 10.1128/MCB.01468-09. Epub 2010 Mar 29. [Article]
  9. Yamaguchi F, Umeda Y, Shimamoto S, Tsuchiya M, Tokumitsu H, Tokuda M, Kobayashi R: S100 proteins modulate protein phosphatase 5 function: a link between CA2+ signal transduction and protein dephosphorylation. J Biol Chem. 2012 Apr 20;287(17):13787-98. doi: 10.1074/jbc.M111.329771. Epub 2012 Mar 7. [Article]
  10. Smith SP, Shaw GS: A novel calcium-sensitive switch revealed by the structure of human S100B in the calcium-bound form. Structure. 1998 Feb 15;6(2):211-22. [Article]
  11. McClintock KA, Shaw GS: A novel S100 target conformation is revealed by the solution structure of the Ca2+-S100B-TRTK-12 complex. J Biol Chem. 2003 Feb 21;278(8):6251-7. Epub 2002 Dec 11. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
CalciumnutraceuticalunknowntargetDetails
Arundic acidinvestigationalyestargetmodulatorDetails
Olopatadineapprovedunknowntargetother/unknownDetails
(Z)-2-[2-(4-methylpiperazin-1-yl)benzyl]diazenecarbothioamideexperimentalunknowntargetDetails
2-[(5-hex-1-yn-1-ylfuran-2-yl)carbonyl]-N-methylhydrazinecarbothioamideexperimentalunknowntargetDetails
N-FormylmethionineexperimentalunknowntargetDetails
Calcium citrateapproved, investigationalnotargetligandDetails
Calcium PhosphateapprovednotargetligandDetails
Calcium phosphate dihydrateapprovednotargetDetails