Tautomerase PptA
Details
- Name
- Tautomerase PptA
- Kind
- protein
- Synonyms
- 5.3.2.-
- ydcE
- Gene Name
- pptA
- UniProtKB Entry
- P31992Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0011161|Tautomerase PptA MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEI APQMEALIKKPGYSMNA
- Number of residues
- 77
- Molecular Weight
- 8672.84
- Theoretical pI
- 4.66
- GO Classification
- Functionsintramolecular oxidoreductase activity, interconverting keto- and enol-groupsProcessescellular aromatic compound metabolic processComponentscytoplasm
- General Function
- Can use enol isomers of phenylpyruvate, 2-hydroxy-2,4-pentadienoate and (p-hydroxyphenyl)pyruvate as substrates.
- Specific Function
- intramolecular oxidoreductase activity, interconverting keto- and enol-groups
- Pfam Domain Function
- Tautomerase (PF01361)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0011162|Tautomerase PptA (pptA) ATGCCGCACATCGACATTAAATGTTTTCCGCGTGAACTGGACGAACAACAAAAAGCAGCA CTTGCTGCAGATATTACCGACGTTATTATTCGTCATCTGAACAGTAAAGACAGTTCGATA AGCATTGCTCTACAGCAGATTCAACCAGAATCTTGGCAAGCTATCTGGGATGCCGAAATC GCGCCCCAAATGGAGGCTTTGATAAAGAAACCTGGTTATAGCATGAATGCTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P31992 UniProtKB Entry Name PPTA_ECOLI GenBank Protein ID 4377521 GenBank Gene ID X60998 PDB ID(s) 1GYJ, 1GYX, 1GYY KEGG ID ecj:JW1456 NCBI Gene ID 945731 - General References
- Zhao S, Sandt CH, Feulner G, Vlazny DA, Gray JA, Hill CW: Rhs elements of Escherichia coli K-12: complex composites of shared and unique components that have different evolutionary histories. J Bacteriol. 1993 May;175(10):2799-808. [Article]
- Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Almrud JJ, Kern AD, Wang SC, Czerwinski RM, Johnson WH Jr, Murzin AG, Hackert ML, Whitman CP: The crystal structure of YdcE, a 4-oxalocrotonate tautomerase homologue from Escherichia coli, confirms the structural basis for oligomer diversity. Biochemistry. 2002 Oct 8;41(40):12010-24. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details (E)-2-Fluoro-P-Hydroxycinnamate experimental unknown target Details