50S ribosomal protein L27
Details
- Name
- 50S ribosomal protein L27
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- rpmA
- UniProtKB Entry
- P60493Swiss-Prot
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- NCBI Taxonomy ID
- 300852
- Amino acid sequence
>lcl|BSEQ0012314|50S ribosomal protein L27 MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLF ALVDGVVEFQDRGRLGRYVHVRPLA
- Number of residues
- 85
- Molecular Weight
- 9508.0
- Theoretical pI
- 12.19
- GO Classification
- Functionsstructural constituent of ribosomeProcessestranslationComponentsribosome
- General Function
- Found on the solvent side of the large subunit.
- Specific Function
- structural constituent of ribosome
- Pfam Domain Function
- Ribosomal_L27 (PF01016)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0012315|50S ribosomal protein L27 (rpmA) ATGGCGCATAAAAAGGGTCTAGGTTCCACGAGGAACGGCCGCGACTCCCAGGCCAAGCGC CTCGGGGTCAAGCGGTACGAGGGCCAGGTGGTCCGGGCGGGCAACATCCTGGTGCGCCAG CGGGGCACCAGGTTCAAGCCCGGCAAGAACGTGGGCATGGGCCGGGACTTCACCCTCTTC GCCCTGGTGGACGGGGTGGTGGAGTTCCAGGACCGGGGCCGTCTCGGTCGGTACGTTCAC GTGCGCCCCTTGGCCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P60493 UniProtKB Entry Name RL27_THET8 GenBank Gene ID AP008226 PDB ID(s) 1V8Q, 1VVJ, 1VY4, 1VY5, 1VY6, 1VY7, 4L47, 4L71, 4LEL, 4LFZ, 4LNT, 4LSK, 4LT8, 4P6F, 4P70, 4TUA, 4TUB, 4TUC, 4TUD, 4TUE, 4V4P, 4V4X, 4V4Y, 4V4Z, 4V51, 4V5A, 4V5C, 4V5D, 4V5E, 4V5F, 4V5G, 4V5J, 4V5K, 4V5L, 4V5M, 4V5N, 4V5P, 4V5Q, 4V5R, 4V5S, 4V68, 4V6A, 4V6F, 4V6G, 4V7J, 4V7K, 4V7L, 4V7M, 4V7W, 4V7X, 4V7Y, 4V7Z, 4V87, 4V8A, 4V8B, 4V8C, 4V8D, 4V8E, 4V8F, 4V8G, 4V8H, 4V8I, 4V8J, 4V8N, 4V8O, 4V8Q, 4V8U, 4V8X, 4V90, 4V95, 4V97, 4V9A, 4V9B, 4V9H, 4V9I, 4V9R, 4V9S, 4W2E, 4W2F, 4W2G, 4W2H, 4W2I, 4W4G, 4WPO, 4WQ1, 4WQF, 4WQR, 4WQU, 4WQY, 4WR6, 4WRA, 4WRO, 4WSD, 4WSM, 4WT1, 4WT8, 4WU1, 4WZD, 4WZO, 4Y4O, 4Y4P, 4YPB, 4YZV, 4Z3Q, 4Z3R, 4Z3S, 4Z8C, 4ZER, 5A9Z, 5AA0, 5D8B KEGG ID ttj:TTHA1782 NCBI Gene ID 3168387 - General References
- Katsani KR, Tsiboli P, Anagnostopoulos K, Urlaub H, Choli-Papadopoulou T: Identification of the 50S ribosomal proteins from the Eubacterium Thermus thermophilus. Biol Chem. 2000 Nov;381(11):1079-87. [Article]
- Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
- Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
- Wang H, Takemoto CH, Murayama K, Sakai H, Tatsuguchi A, Terada T, Shirouzu M, Kuramitsu S, Yokoyama S: Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8. Protein Sci. 2004 Oct;13(10):2806-10. Epub 2004 Aug 31. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 1,4-Dithiothreitol experimental unknown target Details