Calcium/calmodulin-dependent protein kinase type IV
Details
- Name
- Calcium/calmodulin-dependent protein kinase type IV
- Kind
- protein
- Synonyms
- 2.7.11.17
- CaM kinase-GR
- CAMK
- CaMK IV
- CAMK-GR
- CAMKIV
- Gene Name
- CAMK4
- UniProtKB Entry
- Q16566Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0007725|Calcium/calmodulin-dependent protein kinase type IV MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
- Number of residues
- 473
- Molecular Weight
- 51925.05
- Theoretical pI
- 5.58
- GO Classification
- FunctionsATP binding / calcium-dependent protein serine/threonine kinase activity / calmodulin binding / calmodulin-dependent protein kinase activityProcessesadaptive immune response / inflammatory response / intracellular signal transduction / long-term memory / myeloid dendritic cell differentiation / protein phosphorylation / regulation of osteoclast differentiation / regulation of T cell differentiation in thymus / signal transductionComponentscytoplasm / extracellular exosome / nucleoplasm
- General Function
- Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK4 signaling cascade and regulates, mainly by phosphorylation, the activity of several transcription activators, such as CREB1, MEF2D, JUN and RORA, which play pivotal roles in immune response, inflammation, and memory consolidation. In the thymus, regulates the CD4(+)/CD8(+) double positive thymocytes selection threshold during T-cell ontogeny. In CD4 memory T-cells, is required to link T-cell antigen receptor (TCR) signaling to the production of IL2, IFNG and IL4 (through the regulation of CREB and MEF2). Regulates the differentiation and survival phases of osteoclasts and dendritic cells (DCs). Mediates DCs survival by linking TLR4 and the regulation of temporal expression of BCL2. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei and contribute to memory consolidation and long term potentiation (LTP) in the hippocampus. Can activate the MAP kinases MAPK1/ERK2, MAPK8/JNK1 and MAPK14/p38 and stimulate transcription through the phosphorylation of ELK1 and ATF2. Can also phosphorylate in vitro CREBBP, PRM2, MEF2A and STMN1/OP18
- Specific Function
- ATP binding
- Pfam Domain Function
- Pkinase (PF00069)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0020733|Calcium/calmodulin-dependent protein kinase type IV (CAMK4) ATGCTCAAAGTCACGGTGCCCTCCTGCTCCGCCTCGTCCTGCTCTTCGGTCACCGCCAGT GCGGCCCCGGGGACCGCGAGCCTCGTCCCGGATTACTGGATCGACGGCTCCAACAGGGAT GCGCTGAGCGATTTCTTCGAGGTGGAGTCGGAGCTGGGACGGGGTGCTACATCCATTGTG TACAGATGCAAACAGAAGGGGACCCAGAAGCCTTATGCTCTCAAAGTGTTAAAGAAAACA GTGGACAAAAAAATCGTAAGAACTGAGATAGGAGTTCTTCTTCGCCTCTCACATCCAAAC ATTATAAAACTTAAAGAGATATTTGAAACCCCTACAGAAATCAGTCTGGTCCTAGAACTC GTCACAGGAGGAGAACTGTTTGATAGGATTGTGGAAAAGGGATATTACAGTGAGCGAGAT GCTGCAGATGCCGTTAAACAAATCCTGGAGGCAGTTGCTTATCTACATGAAAATGGGATT GTCCATCGTGATCTCAAACCAGAGAATCTTCTTTATGCAACTCCAGCCCCAGATGCACCA CTCAAAATCGCTGATTTTGGACTCTCTAAAATTGTGGAACATCAAGTGCTCATGAAGACA GTATGTGGAACCCCAGGGTACTGCGCACCTGAAATTCTTAGAGGTTGTGCCTATGGACCT GAGGTGGACATGTGGTCTGTAGGAATAATCACCTACATCTTACTTTGTGGATTTGAACCA TTCTATGATGAAAGAGGCGATCAGTTCATGTTCAGGAGAATTCTGAATTGTGAATATTAC TTTATCTCCCCCTGGTGGGATGAAGTATCTCTAAATGCCAAGGACTTGGTCAGAAAATTA ATTGTTTTGGATCCAAAGAAACGGCTGACTACATTTCAAGCTCTCCAGCATCCGTGGGTC ACAGGTAAAGCAGCCAATTTTGTACACATGGATACCGCTCAAAAGAAGCTCCAAGAATTC AATGCCCGGCGTAAGCTTAAGGCAGCGGTGAAGGCTGTGGTGGCCTCTTCCCGCCTGGGA AGTGCCAGCAGCAGCCATGGCAGCATCCAGGAGAGCCACAAGGCTAGCCGAGACCCTTCT CCAATCCAAGATGGCAACGAGGACATGAAAGCTATTCCAGAAGGAGAGAAAATTCAAGGC GATGGGGCCCAAGCCGCAGTTAAGGGGGCACAGGCTGAGCTGATGAAGGTGCAAGCCTTA GAGAAAGTTAAAGGTGCAGATATAAATGCTGAAGAGGCCCCCAAAATGGTGCCCAAGGCA GTGGAGGATGGGATAAAGGTGGCTGACCTGGAACTAGAGGAGGGCCTAGCAGAGGAGAAG CTGAAGACTGTGGAGGAGGCAGCAGCTCCCAGAGAAGGGCAAGGAAGCTCTGCTGTGGGT TTTGAAGTTCCACAGCAAGATGTGATCCTGCCAGAGTACTAA
- Chromosome Location
- 5
- Locus
- 5q22.1
- External Identifiers
Resource Link UniProtKB ID Q16566 UniProtKB Entry Name KCC4_HUMAN GenBank Protein ID 871845 GenBank Gene ID D30742 GeneCard ID CAMK4 HGNC ID HGNC:1464 PDB ID(s) 2W4O KEGG ID hsa:814 NCBI Gene ID 814 - General References
- Kitani T, Okuno S, Fujisawa H: cDNA cloning and expression of human calmodulin-dependent protein kinase IV. J Biochem. 1994 Apr;115(4):637-40. [Article]
- Bland MM, Monroe RS, Ohmstede CA: The cDNA sequence and characterization of the Ca2+/calmodulin-dependent protein kinase-Gr from human brain and thymus. Gene. 1994 May 16;142(2):191-7. [Article]
- Mosialos G, Hanissian SH, Jawahar S, Vara L, Kieff E, Chatila TA: A Ca2+/calmodulin-dependent protein kinase, CaM kinase-Gr, expressed after transformation of primary human B lymphocytes by Epstein-Barr virus (EBV) is induced by the EBV oncogene LMP1. J Virol. 1994 Mar;68(3):1697-705. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Hanissian SH, Frangakis M, Bland MM, Jawahar S, Chatila TA: Expression of a Ca2+/calmodulin-dependent protein kinase, CaM kinase-Gr, in human T lymphocytes. Regulation of kinase activity by T cell receptor signaling. J Biol Chem. 1993 Sep 25;268(27):20055-63. [Article]
- Tokumitsu H, Brickey DA, Glod J, Hidaka H, Sikela J, Soderling TR: Activation mechanisms for Ca2+/calmodulin-dependent protein kinase IV. Identification of a brain CaM-kinase IV kinase. J Biol Chem. 1994 Nov 18;269(46):28640-7. [Article]
- Matthews RP, Guthrie CR, Wailes LM, Zhao X, Means AR, McKnight GS: Calcium/calmodulin-dependent protein kinase types II and IV differentially regulate CREB-dependent gene expression. Mol Cell Biol. 1994 Sep;14(9):6107-16. [Article]
- Bito H, Deisseroth K, Tsien RW: CREB phosphorylation and dephosphorylation: a Ca(2+)- and stimulus duration-dependent switch for hippocampal gene expression. Cell. 1996 Dec 27;87(7):1203-14. [Article]
- Chatila T, Anderson KA, Ho N, Means AR: A unique phosphorylation-dependent mechanism for the activation of Ca2+/calmodulin-dependent protein kinase type IV/GR. J Biol Chem. 1996 Aug 30;271(35):21542-8. [Article]
- Enslen H, Tokumitsu H, Stork PJ, Davis RJ, Soderling TR: Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade. Proc Natl Acad Sci U S A. 1996 Oct 1;93(20):10803-8. [Article]
- Melander Gradin H, Marklund U, Larsson N, Chatila TA, Gullberg M: Regulation of microtubule dynamics by Ca2+/calmodulin-dependent kinase IV/Gr-dependent phosphorylation of oncoprotein 18. Mol Cell Biol. 1997 Jun;17(6):3459-67. [Article]
- Blaeser F, Ho N, Prywes R, Chatila TA: Ca(2+)-dependent gene expression mediated by MEF2 transcription factors. J Biol Chem. 2000 Jan 7;275(1):197-209. [Article]
- Takai N, Miyazaki T, Nishida M, Nasu K, Miyakawa I: Ca(2+)/calmodulin-dependent protein kinase IV expression in epithelial ovarian cancer. Cancer Lett. 2002 Sep 26;183(2):185-93. [Article]
- Anderson KA, Noeldner PK, Reece K, Wadzinski BE, Means AR: Regulation and function of the calcium/calmodulin-dependent protein kinase IV/protein serine/threonine phosphatase 2A signaling complex. J Biol Chem. 2004 Jul 23;279(30):31708-16. Epub 2004 May 13. [Article]
- Chow FA, Anderson KA, Noeldner PK, Means AR: The autonomous activity of calcium/calmodulin-dependent protein kinase IV is required for its role in transcription. J Biol Chem. 2005 May 27;280(21):20530-8. Epub 2005 Mar 15. [Article]
- Illario M, Giardino-Torchia ML, Sankar U, Ribar TJ, Galgani M, Vitiello L, Masci AM, Bertani FR, Ciaglia E, Astone D, Maulucci G, Cavallo A, Vitale M, Cimini V, Pastore L, Means AR, Rossi G, Racioppi L: Calmodulin-dependent kinase IV links Toll-like receptor 4 signaling with survival pathway of activated dendritic cells. Blood. 2008 Jan 15;111(2):723-31. Epub 2007 Oct 1. [Article]
- Fukushima H, Maeda R, Suzuki R, Suzuki A, Nomoto M, Toyoda H, Wu LJ, Xu H, Zhao MG, Ueda K, Kitamoto A, Mamiya N, Yoshida T, Homma S, Masushige S, Zhuo M, Kida S: Upregulation of calcium/calmodulin-dependent protein kinase IV improves memory formation and rescues memory loss with aging. J Neurosci. 2008 Oct 1;28(40):9910-9. doi: 10.1523/JNEUROSCI.2625-08.2008. [Article]
- Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [Article]
- Dias WB, Cheung WD, Wang Z, Hart GW: Regulation of calcium/calmodulin-dependent kinase IV by O-GlcNAc modification. J Biol Chem. 2009 Aug 7;284(32):21327-37. doi: 10.1074/jbc.M109.007310. Epub 2009 Jun 8. [Article]
- Krebs J: Calmodulin-dependent protein kinase IV: regulation of function and expression. Biochim Biophys Acta. 1998 Dec 10;1448(2):183-9. [Article]
- Wayman GA, Lee YS, Tokumitsu H, Silva AJ, Soderling TR: Calmodulin-kinases: modulators of neuronal development and plasticity. Neuron. 2008 Sep 25;59(6):914-31. doi: 10.1016/j.neuron.2008.08.021. [Article]
- Racioppi L, Means AR: Calcium/calmodulin-dependent kinase IV in immune and inflammatory responses: novel routes for an ancient traveller. Trends Immunol. 2008 Dec;29(12):600-7. doi: 10.1016/j.it.2008.08.005. Epub 2008 Oct 17. [Article]
- Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details K-00546 experimental unknown target Details 3-({[(3S)-3,4-dihydroxybutyl]oxy}amino)-1H,2'H-2,3'-biindol-2'-one experimental unknown target Details