Identification
- Generic Name
- Atacicept
- DrugBank Accession Number
- DB06399
- Background
Atacicept is a recombinant fusion protein combined with the extracellular ligand binding portion of TACI.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Fusion proteins - Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>8669_F|atacicept|Homo sapiens||FUSION-TNFRSF13B-GAMMA-1 (TNFRSF13B(Pr30-110)(1-81)+HINGE-REGION(82-96)+CH2(97-206)+CH3(207-313))|||||||313||||MW 35372.1|MW 35372.1| AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISC ASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
Download FASTA Format- Synonyms
- Atacicept
- Human Transmembrane Activator and CAML Interactor (TACI) Immunoglobulin G1 Fc Domain Fusion Protein (Fc5)
- TACI-Fc5
- TACI-IG
Pharmacology
- Indication
Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid).
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
Avoid life-threatening adverse drug eventsImprove clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.- Pharmacodynamics
Not Available
- Mechanism of action
Atacicept contains the soluble TACI receptor that binds to the cytokines BLyS and APRIL. These cytokines are members of the tumor necrosis factor family that promote B-cell survival and autoantibody production associated with certain autoimmune diseases such as systemic lupus erythematosus. Current data indicates that levels of BLyS and APRIL are elevated in patients with rheumatoid arthritis, lupus erythematosus, B-cell malignancies and multiple sclerosis. Atacicept has been shown to affect several stages of B-cell development and may inhibit the survival of cells responsible for making antibodies.
- Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- Not Available
Categories
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- K3D9A0ICQ3
- CAS number
- 845264-92-8
References
- General References
- Not Available
- External Links
- Wikipedia
- Atacicept
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 3 Recruiting Treatment Lupus Nephritis (LN) 1 2 Active Not Recruiting Treatment Berger Disease / IgA Nephropathy (IgAN) 1 2 Completed Treatment Rheumatoid Arthritis 3 2 Completed Treatment Systemic Lupus Erythematosus (SLE) 1 2 Terminated Treatment IgA Nephropathy (IgAN) 1 2 Terminated Treatment Optic Neuritis 1 2 Terminated Treatment Relapsing Multiple Sclerosis (RMS) 2 2 Terminated Treatment Systemic Lupus Erythematosus (SLE) 1 2 Withdrawn Treatment Systemic Lupus Erythematosus (SLE) 1 2, 3 Completed Treatment Systemic Lupus Erythematosus (SLE) 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Drug created at March 19, 2008 16:28 / Updated at February 21, 2021 18:52