Orexin receptor type 2

Details

Name
Orexin receptor type 2
Synonyms
  • Hypocretin receptor type 2
  • Ox-2-R
Gene Name
HCRTR2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0013976|Orexin receptor type 2
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
Number of residues
444
Molecular Weight
50693.965
Theoretical pI
Not Available
GO Classification
Functions
neuropeptide receptor activity / orexin receptor activity / peptide binding / peptide hormone binding
Processes
cellular response to hormone stimulus / circadian sleep/wake cycle process / feeding behavior / neuropeptide signaling pathway / phospholipase C-activating G-protein coupled receptor signaling pathway / regulation of circadian sleep/wake cycle, sleep / response to peptide / synaptic transmission
Components
integral component of plasma membrane / plasma membrane
General Function
Peptide hormone binding
Specific Function
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides.
Pfam Domain Function
Transmembrane Regions
55-75 89-110 128-150 173-193 225-247 305-327 343-366
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013977|Orexin receptor type 2 (HCRTR2)
ATGTCCGGCACCAAATTGGAGGACTCCCCCCCTTGTCGCAACTGGTCATCTGCTTCGGAG
CTGAATGAAACTCAAGAGCCCTTTTTAAACCCCACCGACTATGACGACGAGGAATTCCTG
CGGTACCTGTGGAGGGAATACCTGCACCCGAAAGAATATGAGTGGGTCCTGATCGCCGGG
TACATCATCGTGTTCGTCGTGGCTCTCATTGGGAACGTCCTGGTTTGTGTGGCAGTGTGG
AAGAACCACCACATGAGGACGGTAACCAACTACTTCATAGTCAATCTTTCTCTGGCTGAT
GTGCTCGTGACCATCACCTGCCTTCCAGCCACACTGGTCGTGGATATCACTGAGACCTGG
TTTTTTGGACAGTCCCTTTGCAAAGTGATTCCTTATCTACAGACCGTGTCGGTGTCTGTG
TCTGTCCTCACACTGAGCTGTATCGCCTTGGATCGGTGGTATGCAATCTGTCACCCTTTG
ATGTTTAAGAGCACAGCAAAGCGGGCCCGTAACAGCATTGTCATCATCTGGATTGTCTCC
TGCATTATAATGATTCCTCAGGCCATCGTCATGGAGTGCAGCACCGTGTTCCCAGGCTTA
GCCAATAAAACCACCCTCTTTACGGTGTGTGATGAGCGCTGGGGTGGTGAAATTTATCCC
AAGATGTACCACATCTGTTTCTTTCTGGTGACATACATGGCACCACTGTGTCTCATGGTG
TTGGCTTATCTGCAAATATTTCGCAAACTCTGGTGTCGACAGATCCCTGGAACATCATCT
GTAGTTCAGAGAAAATGGAAGCCCCTGCAGCCTGTTTCACAGCCTCGAGGGCCAGGACAG
CCAACGAAGTCCCGGATGAGCGCTGTGGCGGCTGAAATAAAGCAGATCCGAGCCAGAAGG
AAAACAGCCCGGATGTTGATGATTGTGCTTTTGGTATTTGCAATTTGCTATCTACCAATT
AGCATCCTCAATGTGCTAAAGAGAGTATTTGGGATGTTTGCCCATACTGAAGACAGAGAG
ACTGTGTATGCCTGGTTTACCTTTTCACACTGGCTTGTATATGCCAATAGTGCTGCGAAT
CCAATTATTTATAATTTTCTCAGTGGAAAATTTCGAGAGGAATTTAAAGCTGCGTTTTCT
TGCTGTTGCCTTGGAGTTCACCATCGCCAGGAGGATCGGCTCACCAGGGGACGAACTAGC
ACAGAGAGCCGGAAGTCCTTGACCACTCAAATCAGCAACTTTGATAACATATCAAAACTT
TCTGAGCAAGTTGTGCTCACTAGCATAAGCACACTCCCAGCAGCCAATGGAGCAGGACCA
CTTCAAAACTGGTAG
Chromosome Location
6
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO43614
UniProtKB Entry NameOX2R_HUMAN
HGNC IDHGNC:4849
General References
  1. Sakurai T, Amemiya A, Ishii M, Matsuzaki I, Chemelli RM, Tanaka H, Williams SC, Richardson JA, Kozlowski GP, Wilson S, Arch JR, Buckingham RE, Haynes AC, Carr SA, Annan RS, McNulty DE, Liu WS, Terrett JA, Elshourbagy NA, Bergsma DJ, Yanagisawa M: Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior. Cell. 1998 Feb 20;92(4):573-85. [Article]
  2. Olafsdottir BR, Rye DB, Scammell TE, Matheson JK, Stefansson K, Gulcher JR: Polymorphisms in hypocretin/orexin pathway genes and narcolepsy. Neurology. 2001 Nov 27;57(10):1896-9. [Article]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [Article]
  4. Hungs M, Mignot E: Hypocretin/orexin, sleep and narcolepsy. Bioessays. 2001 May;23(5):397-408. [Article]
  5. Willie JT, Chemelli RM, Sinton CM, Yanagisawa M: To eat or to sleep? Orexin in the regulation of feeding and wakefulness. Annu Rev Neurosci. 2001;24:429-58. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09034Suvorexantapproved, investigationalyesantagonistDetails
DB11951Lemborexantapproved, investigationalyesantagonistDetails