Voltage-dependent calcium channel gamma-3 subunit

Details

Name
Voltage-dependent calcium channel gamma-3 subunit
Synonyms
  • Neuronal voltage-gated calcium channel gamma-3 subunit
  • TARP gamma-3
  • Transmembrane AMPAR regulatory protein gamma-3
Gene Name
CACNG3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051568|Voltage-dependent calcium channel gamma-3 subunit
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
Number of residues
315
Molecular Weight
35548.14
Theoretical pI
Not Available
GO Classification
Functions
channel regulator activity / voltage-gated calcium channel activity
Processes
calcium ion transmembrane transport / calcium ion transport / cardiac conduction / protein localization / protein targeting / regulation of AMPA receptor activity / transmission of nerve impulse
Components
AMPA glutamate receptor complex / endocytic vesicle membrane / plasma membrane / somatodendritic compartment / voltage-gated calcium channel complex
General Function
Regulates the trafficking to the somatodendritic compartment and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Specific Function
Channel regulator activity
Pfam Domain Function
Transmembrane Regions
8-28 104-124 135-155 181-201
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0051569|Voltage-dependent calcium channel gamma-3 subunit (CACNG3)
ATGAGGATGTGTGACAGAGGTATCCAGATGTTGATCACCACTGTAGGAGCCTTTGCCGCT
TTTAGTTTAATGACCATTGCAGTGGGCACGGACTACTGGTTATATTCCAGAGGTGTGTGC
AGGACTAAATCTACAAGTGATAATGAAACCAGCAGGAAGAATGAAGAAGTAATGACCCAT
TCGGGGCTGTGGAGGACCTGCTGCCTAGAAGGGGCTTTCCGAGGCGTGTGCAAGAAAATC
GATCACTTCCCTGAAGATGCTGACTACGAACAGGACACAGCCGAATATCTCCTGCGAGCT
GTGAGGGCCTCCAGTGTCTTCCCCATCCTCAGTGTCACGCTGCTGTTCTTCGGCGGGCTC
TGCGTGGCAGCCAGTGAGTTCCACCGCAGCAGACACAACGTCATTCTCAGCGCGGGCATC
TTTTTTGTCTCTGCAGGGTTAAGCAACATCATTGGCATCATAGTTTATATATCAGCCAAC
GCCGGAGACCCCGGGCAGCGTGACTCCAAAAAAAGTTACTCCTATGGTTGGTCCTTTTAT
TTCGGAGCCTTCTCTTTCATCATCGCAGAAATTGTAGGAGTGGTTGCCGTGCACATCTAT
ATTGAAAAACATCAGCAGTTACGAGCCAAATCCCACTCGGAGTTCCTGAAGAAATCTACT
TTTGCCCGCCTCCCACCCTACAGGTATCGATTCCGGAGGCGGTCAAGTTCTCGCTCCACC
GAGCCCAGATCCCGAGACCTGTCCCCCATCAGCAAAGGCTTCCACACCATCCCTTCCACT
GACATCTCGATGTTCACCCTCTCCCGGGACCCCTCAAAGATCACCATGGGGACCCTCCTC
AACTCCGACCGGGACCACGCTTTTCTACAGTTCCACAATTCCACACCCAAAGAGTTCAAA
GAGTCACTGCATAATAATCCGGCCAACAGGCGCACCACGCCCGTCTGA
Chromosome Location
16
Locus
16p12.1
External Identifiers
ResourceLink
UniProtKB IDO60359
UniProtKB Entry NameCCG3_HUMAN
HGNC IDHGNC:1407
General References
  1. Black JL 3rd, Lennon VA: Identification and cloning of putative human neuronal voltage-gated calcium channel gamma-2 and gamma-3 subunits: neurologic implications. Mayo Clin Proc. 1999 Apr;74(4):357-61. [Article]
  2. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB13746Bioallethrinapproved, experimentalunknownagonistDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails
DB00228Enfluraneapproved, investigational, vet_approvedyesinhibitoractivatorDetails