Receptor activity-modifying protein 3

Details

Name
Receptor activity-modifying protein 3
Synonyms
  • Calcitonin-receptor-like receptor activity-modifying protein 3
  • CRLR activity-modifying protein 3
Gene Name
RAMP3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016229|Receptor activity-modifying protein 3
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS
EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI
PLIVIPVVLTVAMAGLVVWRSKRTDTLL
Number of residues
148
Molecular Weight
16518.325
Theoretical pI
5.15
GO Classification
Functions
coreceptor activity / protein transporter activity / receptor activity
Processes
angiogenesis / calcium ion transport / cellular response to estradiol stimulus / cellular response to hormone stimulus / G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway involved in heart process / intracellular protein transport / negative regulation of transcription, DNA-templated / positive regulation of cAMP biosynthetic process / positive regulation of establishment of protein localization to plasma membrane / positive regulation of receptor recycling / protein localization to plasma membrane / protein transport / receptor internalization / regulation of G-protein coupled receptor protein signaling pathway
Components
cell surface / integral component of plasma membrane / intracellular / lysosome / plasma membrane / receptor complex
General Function
Receptor activity
Specific Function
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Pfam Domain Function
Transmembrane Regions
119-138
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016230|Receptor activity-modifying protein 3 (RAMP3)
ATGGAGACTGGAGCGCTGCGGCGCCCGCAACTTCTCCCGTTGCTGCTGCTGCTCTGCGGT
GGGTGTCCCAGAGCAGGCGGCTGCAACGAGACAGGCATGTTGGAGAGGCTGCCCCTGTGT
GGGAAGGCTTTCGCAGACATGATGGGCAAGGTGGACGTCTGGAAGTGGTGCAACCTGTCC
GAGTTCATCGTGTACTATGAGAGTTTCACCAACTGCACCGAGATGGAGGCCAATGTCGTG
GGCTGCTACTGGCCCAACCCCCTGGCCCAGGGCTTCATCACCGGCATCCACAGGCAGTTC
TTCTCCAACTGCACCGTGGACAGGGTCCACTTGGAGGACCCCCCAGACGAGGTTCTCATC
CCGCTGATCGTTATACCCGTCGTTCTGACTGTCGCCATGGCTGGCCTGGTGGTGTGGCGC
AGCAAACGCACCGACACGCTGCTGTGA
Chromosome Location
7
Locus
7p13-p12
External Identifiers
ResourceLink
UniProtKB IDO60896
UniProtKB Entry NameRAMP3_HUMAN
GenBank Protein ID3171914
GenBank Gene IDAJ001016
GenAtlas IDRAMP3
HGNC IDHGNC:9845
General References
  1. McLatchie LM, Fraser NJ, Main MJ, Wise A, Brown J, Thompson N, Solari R, Lee MG, Foord SM: RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature. 1998 May 28;393(6683):333-9. [Article]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Lenhart PM, Broselid S, Barrick CJ, Leeb-Lundberg LM, Caron KM: G-protein-coupled receptor 30 interacts with receptor activity-modifying protein 3 and confers sex-dependent cardioprotection. J Mol Endocrinol. 2013 Jul 3;51(1):191-202. doi: 10.1530/JME-13-0021. Print 2013. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01278Pramlintideapproved, investigationalyesagonistDetails