Tryptophan synthase alpha chain
Details
- Name
- Tryptophan synthase alpha chain
- Synonyms
- 4.2.1.20
- Gene Name
- trpA
- UniProtKB Entry
- P00929Swiss-Prot
- Organism
- Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
- NCBI Taxonomy ID
- 99287
- Amino acid sequence
>lcl|BSEQ0017318|Tryptophan synthase alpha chain MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI IEKNLASPKQMLAELRSFVSAMKAASRA
- Number of residues
- 268
- Molecular Weight
- 28670.485
- Theoretical pI
- 5.34
- GO Classification
- Functionstryptophan synthase activity
- General Function
- The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate.
- Specific Function
- tryptophan synthase activity
- Pfam Domain Function
- Trp_syntA (PF00290)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0017319|Tryptophan synthase alpha chain (trpA) ATGGAACGCTACGAAAATTTATTTGCCCAACTCAACGATCGCCGGGAAGGCGCTTTTGTC CCCTTCGTGACCCTGGGCGACCCTGGCATTGAACAGTCACTGAAAATTATTGACACACTG ATTGACGCTGGCGCCGACGCTCTGGAACTGGGGGTTCCCTTCTCCGATCCGCTGGCCGAT GGCCCTACCATCCAGAATGCGAACTTACGCGCCTTCGCCGCTGGCGTCACGCCGGCTCAG TGTTTTGAAATGCTGGCGCTGATTCGTGAAAAACACCCGACCATTCCGATTGGCCTGCTA ATGTACGCGAATCTGGTGTTCAATAACGGCATAGATGCGTTCTATGCCCGTTGTGAACAG GTTGGCGTAGATTCCGTGCTGGTCGCAGATGTCCCGGTTGAAGAATCGGCCCCCTTCCGC CAGGCAGCGTTACGGCATAATATCGCGCCGATCTTCATCTGCCCGCCAAATGCGGATGAC GATCTTCTGCGCCAGGTCGCATCTTACGGCCGCGGTTACACCTACCTGCTTTCGCGTTCG GGTGTCACCGGCGCGGAAAACCGTGGCGCATTGCCGTTGCATCATCTCATTGAGAAGCTT AAAGAGTACCATGCCGCGCCTGCGTTACAGGGCTTCGGTATCTCCTCGCCGGAACAGGTG TCTGCGGCCGTGCGTGCCGGGGCGGCTGGCGCTATCTCCGGCTCAGCCATTGTCAAGATT ATCGAGAAAAACCTCGCGTCTCCCAAACAGATGTTGGCGGAGCTCAGGTCCTTTGTCTCA GCCATGAAAGCCGCCAGCCGCGCATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00929 UniProtKB Entry Name TRPA_SALTY GenBank Protein ID 47939 GenBank Gene ID V01376 PDB ID(s) 1A50, 1A5A, 1A5B, 1A5S, 1BEU, 1BKS, 1C29, 1C8V, 1C9D, 1CW2, 1CX9, 1FUY, 1K3U, 1K7E, 1K7F, 1K7X, 1K8X, 1K8Y, 1K8Z, 1KFB, 1KFC, 1KFE, 1KFJ, 1KFK, 1QOP, 1QOQ, 1TJP, 1TTP, 1TTQ, 1UBS, 1WBJ, 2CLE, 2CLF, 2CLH, 2CLI, 2CLK, 2CLL, 2CLM, 2CLO, 2J9X, 2J9Y, 2J9Z, 2RH9, 2RHG, 2TRS, 2TSY, 2TYS, 2WSY, 3CEP, 3PR2, 4HN4, 4HPJ, 4HPX, 4HT3, 4KKX, 4WX2 KEGG ID stm:STM1727 NCBI Gene ID 1253246 - General References
- Nichols BP, Yanofsky C: Nucleotide sequences of trpA of Salmonella typhimurium and Escherichia coli: an evolutionary comparison. Proc Natl Acad Sci U S A. 1979 Oct;76(10):5244-8. [Article]
- Schneider WP, Nichols BP, Yanofsky C: Procedure for production of hybrid genes and proteins and its use in assessing significance of amino acid differences in homologous tryptophan synthetase alpha polypeptides. Proc Natl Acad Sci U S A. 1981 Apr;78(4):2169-73. [Article]
- McClelland M, Sanderson KE, Spieth J, Clifton SW, Latreille P, Courtney L, Porwollik S, Ali J, Dante M, Du F, Hou S, Layman D, Leonard S, Nguyen C, Scott K, Holmes A, Grewal N, Mulvaney E, Ryan E, Sun H, Florea L, Miller W, Stoneking T, Nhan M, Waterston R, Wilson RK: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2. Nature. 2001 Oct 25;413(6858):852-6. [Article]
- Li SL, Yanofsky C: Amino acid sequence studies with the tryptophan synthetase chain of Salmonella typhimurium. J Biol Chem. 1973 Mar 10;248(5):1830-6. [Article]
- Hyde CC, Ahmed SA, Padlan EA, Miles EW, Davies DR: Three-dimensional structure of the tryptophan synthase alpha 2 beta 2 multienzyme complex from Salmonella typhimurium. J Biol Chem. 1988 Nov 25;263(33):17857-71. [Article]
- Rhee S, Parris KD, Hyde CC, Ahmed SA, Miles EW, Davies DR: Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes. Biochemistry. 1997 Jun 24;36(25):7664-80. [Article]
- Rhee S, Miles EW, Davies DR: Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alphaD60N) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alphaGlu49. J Biol Chem. 1998 Apr 10;273(15):8553-5. [Article]
- Sachpatzidis A, Dealwis C, Lubetsky JB, Liang PH, Anderson KS, Lolis E: Crystallographic studies of phosphonate-based alpha-reaction transition-state analogues complexed to tryptophan synthase. Biochemistry. 1999 Sep 28;38(39):12665-74. [Article]
- Weyand M, Schlichting I: Structural basis for the impaired channeling and allosteric inter-subunit communication in the beta A169L/beta C170W mutant of tryptophan synthase. J Biol Chem. 2000 Dec 29;275(52):41058-63. [Article]
- Kulik V, Weyand M, Seidel R, Niks D, Arac D, Dunn MF, Schlichting I: On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase. J Mol Biol. 2002 Dec 6;324(4):677-90. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Tryptophan synthase alpha chain (Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 2-[(2-NAPHTHYLSULFONYL)AMINO]ETHYL DIHYDROGEN PHOSPHATE experimental unknown target Details 2-{[4-(TRIFLUOROMETHOXY)BENZOYL]AMINO}ETHYL DIHYDROGEN PHOSPHATE experimental unknown target Details 2-({[4-(TRIFLUOROMETHOXY)PHENYL]SULFONYL}AMINO)ETHYL DIHYDROGEN PHOSPHATE experimental unknown target Details 5-FLUOROINDOLE PROPANOL PHOSPHATE experimental unknown target Details 4-(2-HYDROXYPHENYLTHIO)-1-BUTENYLPHOSPHONIC ACID experimental unknown target Details 4-(2-HYDROXY-4-FLUOROPHENYLTHIO)-BUTYLPHOSPHONIC ACID experimental unknown target Details 4-(2-HYDROXYPHENYLSULFINYL)-BUTYLPHOSPHONIC ACID experimental unknown target Details N-(indole-3-acetyl)-L-aspartic acid experimental unknown target Details N-[1H-INDOL-3-YL-ACETYL]GLYCINE ACID experimental unknown target Details N-[1H-INDOL-3-YL-ACETYL]VALINE ACID experimental unknown target Details Indole-3-Glycerol Phosphate experimental unknown target Details Indole-3-Propanol Phosphate experimental unknown target Details