Beta-lactamase OXA-10

Details

Name
Beta-lactamase OXA-10
Synonyms
  • 3.5.2.6
  • Beta-lactamase PSE-2
  • oxa10
  • pse2
Gene Name
bla
Organism
Pseudomonas aeruginosa
Amino acid sequence
>lcl|BSEQ0022273|Beta-lactamase OXA-10
MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARAS
KEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPRAMKQWERDLTLRGAIQVSAVPVF
QQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSA
SKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMD
IDNESKLPLRKSIPTKIMESEGIIGG
Number of residues
266
Molecular Weight
29506.575
Theoretical pI
8.03
GO Classification
Functions
beta-lactamase activity / penicillin binding
Processes
antibiotic catabolic process / response to antibiotic
General Function
Penicillin binding
Specific Function
Hydrolyzes both carbenicillin and oxacillin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0002534|801 bp
ATGAAAACATTTGCCGCATATGTAATTATCGCGTGTCTTTCGAGTACGGCATTAGCTGGT
TCAATTACAGAAAATACGTCTTGGAACAAAGAGTTCTCTGCCGAAGCCGTCAATGGTGTC
TTCGTGCTTTGTAAAAGTAGCAGTAAATCCTGCGCTACCAATGACTTAGCTCGTGCATCA
AAGGAATATCTTCCAGCATCAACATTTAAGATCCCCAACGCAATTATCGGCCTAGAAACT
GGTGTCATAAAGAATGAGCATCAGGTTTTCAAATGGGACGGAAAGCCAAGAGCCATGAAG
CAATGGGAAAGAGACTTGACCTTAAGAGGGGCAATACAAGTTTCAGCTGTTCCCGTATTT
CAACAAATCGCCAGAGAAGTTGGCGAAGTAAGAATGCAGAAATACCTTAAAAAATTTTCC
TATGGCAACCAGAATATCAGTGGTGGCATTGACAAATTCTGGTTGGAAGGCCAGCTTAGA
ATTTCCGCAGTTAATCAAGTGGAGTTTCTAGAGTCTCTATATTTAAATAAATTGTCAGCA
TCTAAAGAAAACCAGCTAATAGTAAAAGAGGCTTTGGTAACGGAGGCGGCACCTGAATAT
CTAGTGCATTCAAAAACTGGTTTTTCTGGTGTGGGAACTGAGTCAAATCCTGGTGTCGCA
TGGTGGGTTGGGTGGGTTGAGAAGGAGACAGAGGTTTACTTTTTCGCCTTTAACATGGAT
ATAGACAACGAAAGTAAGTTGCCGCTAAGAAAATCCATTCCCACCAAAATCATGGAAAGT
GAGGGCATCATTGGTGGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP14489
UniProtKB Entry NameBLO10_PSEAI
GenBank Protein ID1019897
GenBank Gene IDU37105
General References
  1. Huovinen P, Huovinen S, Jacoby GA: Sequence of PSE-2 beta-lactamase. Antimicrob Agents Chemother. 1988 Jan;32(1):134-6. [PubMed:3126705]
  2. Maveyraud L, Golemi D, Kotra LP, Tranier S, Vakulenko S, Mobashery S, Samama JP: Insights into class D beta-lactamases are revealed by the crystal structure of the OXA10 enzyme from Pseudomonas aeruginosa. Structure. 2000 Dec 15;8(12):1289-98. [PubMed:11188693]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB021224-iodo-acetamido phenylboronic acidexperimentalunknownDetails
DB03801Lysine Nz-Carboxylic AcidexperimentalunknownDetails
DB043427-((Carboxy(4-Hydroxyphenyl)Acetyl)Amino)-7-Methoxy-(3-((1-Methyl-1h-Tetrazol-5-Yl)Thio)Methyl)-8-Oxo-5-Oxa-1-Azabicyclo[4.2.0]Oct-2-Ene-2-Carboxylic AcidexperimentalunknownDetails
DB00760Meropenemapproved, investigationalunknownsubstrateDetails