Myeloblastin
Details
- Name
- Myeloblastin
- Synonyms
- 3.4.21.76
- AGP7
- C-ANCA antigen
- Leukocyte proteinase 3
- MBN
- Neutrophil proteinase 4
- NP-4
- P29
- PR-3
- PR3
- Wegener autoantigen
- Gene Name
- PRTN3
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0001900|Myeloblastin MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL IHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYV DWIRSTLRRVEAKGRP
- Number of residues
- 256
- Molecular Weight
- 27806.815
- Theoretical pI
- 8.42
- GO Classification
- Functionsenzyme binding / serine-type endopeptidase activity / serine-type peptidase activityProcessesblood coagulation / collagen catabolic process / mature conventional dendritic cell differentiation / negative regulation of phagocytosis / positive regulation of cell proliferation / proteolysisComponentscytosol / extracellular exosome / extracellular space / plasma membrane
- General Function
- Serine-type peptidase activity
- Specific Function
- Polymorphonuclear leukocyte serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) and causes emphysema when administered by tracheal insufflation to hamsters.
- Pfam Domain Function
- Trypsin (PF00089)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0010671|Myeloblastin (PRTN3) ATGGCTCACCGGCCCCCCAGCCCTGCCCTGGCGTCCGTGCTGCTGGCCTTGCTGCTGAGC GGTGCTGCCCGAGCTGCGGAGATCGTGGGCGGGCACGAGGCGCAGCCACACTCCCGGCCC TACATGGCCTCCCTGCAGATGCGGGGGAACCCGGGCAGCCACTTCTGCGGAGGCACCTTG ATCCACCCCAGCTTCGTGCTGACGGCCGCGCACTGCCTGCGGGACATACCCCAGCGCCTG GTGAACGTGGTGCTCGGAGCCCACAACGTGCGGACGCAGGAGCCCACCCAGCAGCACTTC TCGGTGGCTCAGGTGTTTCTGAACAACTACGACGCGGAGAACAAACTGAACGACGTTCTC CTCATCCAGCTGAGCAGCCCAGCCAACCTCAGTGCCTCCGTCGCCACAGTCCAGCTGCCA CAGCAGGACCAGCCAGTGCCCCACGGCACCCAGTGCCTGGCCATGGGCTGGGGCCGCGTG GGTGCCCACGACCCCCCAGCCCAGGTCCTGCAGGAGCTCAATGTCACCGTGGTCACCTTC TTCTGCCGGCCACATAACATTTGCACTTTCGTCCCTCGCCGCAAGGCCGGCATCTGCTTC GGAGACTCAGGTGGCCCCCTGATCTGTGATGGCATCATCCAAGGAATAGACTCCTTCGTG ATCTGGGGATGTGCCACCCGCCTTTTCCCTGACTTCTTCACGCGGGTAGCCCTCTACGTG GACTGGATCCGTTCCACGCTGCGCCGTGTGGAGGCCAAGGGCCGCCCCTGA
- Chromosome Location
- 19
- Locus
- 19p13.3
- External Identifiers
Resource Link UniProtKB ID P24158 UniProtKB Entry Name PRTN3_HUMAN GenBank Protein ID 187399 GenBank Gene ID M75154 GenAtlas ID PRTN3 HGNC ID HGNC:9495 - General References
- Labbaye C, Musette P, Cayre YE: Wegener autoantigen and myeloblastin are encoded by a single mRNA. Proc Natl Acad Sci U S A. 1991 Oct 15;88(20):9253-6. [Article]
- Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Zimmer M, Medcalf RL, Fink TM, Mattmann C, Lichter P, Jenne DE: Three human elastase-like genes coordinately expressed in the myelomonocyte lineage are organized as a single genetic locus on 19pter. Proc Natl Acad Sci U S A. 1992 Sep 1;89(17):8215-9. [Article]
- Sturrock AB, Franklin KF, Rao G, Marshall BC, Rebentisch MB, Lemons RS, Hoidal JR: Structure, chromosomal assignment, and expression of the gene for proteinase-3. The Wegener's granulomatosis autoantigen. J Biol Chem. 1992 Oct 15;267(29):21193-9. [Article]
- Clave E, Molldrem J, Hensel N, Raptis A, Barrett AJ: Donor-recipient polymorphism of the proteinase 3 gene: a potential target for T-cell alloresponses to myeloid leukemia. J Immunother. 1999 Jan;22(1):1-6. [Article]
- Musette P, Labbaye C, Dorner MH, Cayre YE, Casanova JL, Kourilsky P: Wegener's autoantigen and leukemia. Blood. 1991 Mar 15;77(6):1398-9. [Article]
- Campanelli D, Melchior M, Fu Y, Nakata M, Shuman H, Nathan C, Gabay JE: Cloning of cDNA for proteinase 3: a serine protease, antibiotic, and autoantigen from human neutrophils. J Exp Med. 1990 Dec 1;172(6):1709-15. [Article]
- Bories D, Raynal MC, Solomon DH, Darzynkiewicz Z, Cayre YE: Down-regulation of a serine protease, myeloblastin, causes growth arrest and differentiation of promyelocytic leukemia cells. Cell. 1989 Dec 22;59(6):959-68. [Article]
- Jenne DE, Tschopp J, Ludemann J, Utecht B, Gross WL: Wegener's autoantigen decoded. Nature. 1990 Aug 9;346(6284):520. [Article]
- Rao NV, Wehner NG, Marshall BC, Gray WR, Gray BH, Hoidal JR: Characterization of proteinase-3 (PR-3), a neutrophil serine proteinase. Structural and functional properties. J Biol Chem. 1991 May 25;266(15):9540-8. [Article]
- Wilde CG, Snable JL, Griffith JE, Scott RW: Characterization of two azurphil granule proteases with active-site homology to neutrophil elastase. J Biol Chem. 1990 Feb 5;265(4):2038-41. [Article]
- Ohlsson K, Linder C, Rosengren M: Monoclonal antibodies specific for neutrophil proteinase 4. Production and use for isolation of the enzyme. Biol Chem Hoppe Seyler. 1990 Jul;371(7):549-55. [Article]
- Goldschmeding R, Dolman KM, van den Ende ME, van der Meer-Gerritsen CH, Sonnenberg A, von dem Borne AE: The relation of 29 kD C-ANCA antigen to proteinase 3. APMIS Suppl. 1990;19:26-7. [Article]
- Niles JL, McCluskey RT, Ahmad MF, Arnaout MA: Wegener's granulomatosis autoantigen is a novel neutrophil serine proteinase. Blood. 1989 Nov 1;74(6):1888-93. [Article]
- Gabay JE, Scott RW, Campanelli D, Griffith J, Wilde C, Marra MN, Seeger M, Nathan CF: Antibiotic proteins of human polymorphonuclear leukocytes. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5610-4. [Article]
- Gaskin G, Kendal H, Coulthart A, Turner N, Pusey CD: Use of proteinase 3 purified by reverse phase HPLC to detect autoantibodies in systemic vasculitis. J Immunol Methods. 1995 Mar 13;180(1):25-33. [Article]
- Ludemann J, Utecht B, Gross WL: Anti-neutrophil cytoplasm antibodies in Wegener's granulomatosis recognize an elastinolytic enzyme. J Exp Med. 1990 Jan 1;171(1):357-62. [Article]
- Duke-Cohan JS, Morimoto C, Rocker JA, Schlossman SF: A novel form of dipeptidylpeptidase IV found in human serum. Isolation, characterization, and comparison with T lymphocyte membrane dipeptidylpeptidase IV (CD26). J Biol Chem. 1995 Jun 9;270(23):14107-14. [Article]
- Gupta SK, Niles JL, McCluskey RT, Arnaout MA: Identity of Wegener's autoantigen (p29) with proteinase 3 and myeloblastin. Blood. 1990 Nov 15;76(10):2162. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
- Fujinaga M, Chernaia MM, Halenbeck R, Koths K, James MN: The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies. J Mol Biol. 1996 Aug 16;261(2):267-78. [Article]