Cyclomaltodextrin glucanotransferase

Details

Name
Cyclomaltodextrin glucanotransferase
Synonyms
  • 2.4.1.19
  • CGTase
  • Cyclodextrin-glycosyltransferase
Gene Name
Not Available
Organism
Bacillus circulans
Amino acid sequence
>lcl|BSEQ0016362|Cyclomaltodextrin glucanotransferase
MFQMAKRAFLSTTLTLGLLAGSALPFLPASAVYADPDTAVTNKQSFSTDVIYQVFTDRFL
DGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFAT
INYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAME
TDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNAT
IDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASD
ADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDN
HDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTT
AFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITG
LSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPV
MGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAA
SGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFN
QVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Number of residues
718
Molecular Weight
78046.265
Theoretical pI
6.65
GO Classification
Functions
cyclomaltodextrin glucanotransferase activity / metal ion binding / starch binding
Processes
carbohydrate metabolic process
Components
extracellular region
General Function
Starch binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0002474|2157 bp
ATGTTTCAAATGGCCAAACGCGCATTCCTCAGCACCACACTGACCCTCGGCTTGCTTGCC
GGCAGCGCCCTGCCGTTCTTGCCAGCTTCCGCTGTATACGCCGATCCGGACACTGCTGTG
ACCAACAAACAGAGCTTCAGTACAGATGTGATCTACCAAGTATTTACGGATCGCTTTTTG
GACGGCAATCCCTCCAACAACCCCACCGGAGCCGCTTATGATGCCACATGCAGCAATTTG
AAGCTGTACTGCGGCGGAGACTGGCAAGGGTTAATCAACAAAATCAACGATAACTATTTC
AGTGATCTGGGTGTCACAGCGTTGTGGATCTCCCAGCCTGTCGAAAATATTTTTGCGACG
ATCAACTATAGCGGTGTAACCAATACTGCCTACCACGGCTACTGGGCTCGAGACTTCAAA
AAGACCAATCCGTACTTCGGCACGATGGCGGACTTTCAGAACCTGATTACGACGGCTCAT
GCCAAAGGCATCAAGATTGTCATTGACTTTGCACCGAATCACACCTCTCCAGCGATGGAA
ACCGACACCTCTTTTGCCGAAAATGGCAGACTGTACGATAACGGTACACTGGTAGGCGGT
TATACCAATGATACCAACGGGTACTTCCATCACAATGGCGGCTCCGACTTCTCTTCCCTG
GAGAACGGCATCTACAAAAACCTGTATGACCTGGCCGACTTCAACCACAATAATGCGACC
ATCGACAAATACTTCAAAGATGCGATCAAACTGTGGCTTGATATGGGCGTTGACGGTATT
CGGGTGGATGCGGTGAAACATATGCCTCTCGGTTGGCAAAAGAGCTGGATGTCCTCCATC
TACGCACACAAACCCGTGTTCACTTTTGGAGAATGGTTCTTGGGATCAGCTGCATCCGAT
GCAGATAACACGGATTTTGCTAACAAGTCTGGTATGAGCCTGCTCGACTTCCGCTTTAAC
TCTGCGGTGCGTAATGTGTTCCGTGACAACACGTCCAACATGTACGCTCTGGATTCCATG
ATTAACAGCACAGCTACGGACTACAACCAAGTGAACGATCAGGTGACGTTCATCGACAAC
CATGATATGGATCGTTTCAAAACAAGTGCGGTCAACAATCGCCGTCTGGAACAGGCTTTG
GCCTTCACATTGACTTCACGTGGTGTACCTGCCATCTACTATGGTACTGAACAGTATTTG
ACGGGGAATGGCGATCCAGATAACCGGGCCAAAATGCCTTCGTTCTCCAAATCCACTACA
GCTTTTAACGTCATAAGTAAACTCGCGCCTCTGCGCAAATCCAATCCGGCCATTGCCTAC
GGTTCCACACAGCAGCGCTGGATTAATAATGATGTATATGTTTATGAGCGTAAATTCGGC
AAGAGCGTAGCCGTTGTCGCGGTAAACCGCAATCTTTCCACGTCTGCAAGCATTACAGGG
TTAAGCACTTCCCTGCCTACAGGCTCATACACGGATGTGCTTGGCGGGGTGCTGAACGGA
AATAACATCACCTCCACGAATGGTAGCATTAACAACTTCACCCTTGCTGCGGGTGCAACG
GCAGTATGGCAATACACAACTGCCGAAACAACACCAACCATCGGTCATGTTGGTCCGGTT
ATGGGGAAACCCGGTAATGTGGTGACAATTGATGGCCGTGGATTCGGCTCGACGAAAGGC
ACGGTCTACTTCGGCACTACAGCGGTTACCGGAGCAGCGATTACGTCTTGGGAAGATACA
CAGATTAAAGTAACCATCCCTTCCGTTGCCGCTGGCAACTATGCAGTCAAAGTTGCGGCA
AGCGGGGTAAACAGCAATGCATACAACAACTTCACCATCCTGACTGGCGATCAGGTCACC
GTTCGCTTCGTCGTAAACAATGCGTCCACAACGCTTGGACAGAACCTCTATTTGACAGGC
AACGTAGCCGAGCTTGGCAACTGGAGCACCGGTTCGACTGCCATTGGACCCGCATTCAAT
CAGGTCATTCATCAATACCCAACCTGGTACTATGATGTCAGCGTACCGGCAGGCAAACAG
CTGGAGTTCAAATTTTTCAAGAAAAACGGTTCAACGATTACATGGGAAAGCGGTTCTAAC
CACACATTCACTACACCAGCGAGCGGAACAGCCACCGTTACGGTGAACTGGCAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP30920
UniProtKB Entry NameCDGT1_BACCI
GenBank Protein ID39420
GenBank Gene IDX68326
General References
  1. Nitschke L, Heeger K, Bender H, Schulz GE: Molecular cloning, nucleotide sequence and expression in Escherichia coli of the beta-cyclodextrin glycosyltransferase gene from Bacillus circulans strain no. 8. Appl Microbiol Biotechnol. 1990 Aug;33(5):542-6. [PubMed:1368573]
  2. Klein C, Schulz GE: Structure of cyclodextrin glycosyltransferase refined at 2.0 A resolution. J Mol Biol. 1991 Feb 20;217(4):737-50. [PubMed:1826034]
  3. Hofmann BE, Bender H, Schulz GE: Three-dimensional structure of cyclodextrin glycosyltransferase from Bacillus circulans at 3.4 A resolution. J Mol Biol. 1989 Oct 20;209(4):793-800. [PubMed:2531228]
  4. Schmidt AK, Cottaz S, Driguez H, Schulz GE: Structure of cyclodextrin glycosyltransferase complexed with a derivative of its main product beta-cyclodextrin. Biochemistry. 1998 Apr 28;37(17):5909-15. [PubMed:9558324]
  5. Parsiegla G, Schmidt AK, Schulz GE: Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production. Eur J Biochem. 1998 Aug 1;255(3):710-7. [PubMed:9738912]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01719Thio-MaltopentaoseexperimentalunknownDetails
DB017891-Amino-2,3-Dihydroxy-5-Hydroxymethyl Cyclohex-5-EneexperimentalunknownDetails
DB018414,6-DideoxyglucoseexperimentalunknownDetails
DB01909Alpha-Cyclodextrin (Cyclohexa-Amylose)experimentalunknownDetails
DB021206-Amino-4-Hydroxymethyl-Cyclohex-4-Ene-1,2,3-TriolexperimentalunknownDetails
DB02394OxiranpseudoglucoseexperimentalunknownDetails
DB024694,6-dideoxy-4-amino-beta-D-glucopyranosideexperimentalunknownDetails
DB026704-Deoxy-Alpha-D-GlucoseexperimentalunknownDetails
DB03198Thio-MaltohexaoseexperimentalunknownDetails
DB03323Maltoseexperimental, investigationalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB03773alpha-D-quinovopyranoseexperimentalunknownDetails