Pyruvate oxidase

Details

Name
Pyruvate oxidase
Synonyms
  • 1.2.3.3
  • POX
  • Pyruvic oxidase
Gene Name
pox5
Organism
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Amino acid sequence
>lcl|BSEQ0010945|Pyruvate oxidase
MVMKQTKQTNILAGAAVIKVLEAWGVDHLYGIPGGSINSIMDALSAERDRIHYIQVRHEE
VGAMAAAADAKLTGKIGVCFGSAGPGGTHLMNGLYDAREDHVPVLALIGQFGTTGMNMDT
FQEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYAHQGVAVVQIPVDLPWQQIPAE
DWYASANSYQTPLLPEPDVQAVTRLTQTLLAAERPLIYYGIGARKAGKELEQLSKTLKIP
LMSTYPAKGIVADRYPAYLGSANRVAQKPANEALAQADVVLFVGNNYPFAEVSKAFKNTR
YFLQIDIDPAKLGKRHKTDIAVLADAQKTLAAILAQVSERESTPWWQANLANVKNWRAYL
ASLEDKQEGPLQAYQVLRAVNKIAEPDAIYSIDVGDINLNANRHLKLTPSNRHITSNLFA
TMGVGIPGAIAAKLNYPERQVFNLAGDGGASMTMQDLATQVQYHLPVINVVFTNCQYGFI
KDEQEDTNQNDFIGVEFNDIDFSKIADGVHMQAFRVNKIEQLPDVFEQAKAIAQHEPVLI
DAVITGDRPLPAEKLRLDSATSSAADIEAFKQRYEAQDLQPLSTYLKQFGLDDLQHQIGQ
GGF
Number of residues
603
Molecular Weight
66110.5
Theoretical pI
5.24
GO Classification
Functions
magnesium ion binding / pyruvate oxidase activity / thiamine pyrophosphate binding
General Function
Thiamine pyrophosphate binding
Specific Function
Important for the aerobic growth. Decarboxylates pyruvate in four steps. The energy released is partially stored in acetyl phosphate.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010946|Pyruvate oxidase (pox5)
ATGGTTATGAAACAAACAAAACAAACTAACATACTAGCAGGTGCAGCAGTTATTAAAGTT
TTAGAAGCTTGGGGAGTAGATCATTTGTATGGTATTCCTGGAGGTTCAATTAATTCGATT
ATGGACGCATTATCAGCAGAAAGGGATCGAATCCATTATATTCAAGTACGGCATGAAGAA
GTTGGTGCAATGGCCGCCGCTGCTGATGCTAAGCTAACGGGTAAAATCGGGGTTTGCTTC
GGCTCAGCGGGACCTGGTGGCACTCATCTTATGAATGGGTTATATGATGCGCGTGAAGAC
CATGTCCCTGTTCTAGCGCTTATTGGTCAATTTGGCACTACTGGGATGAACATGGATACG
TTCCAAGAAATGAATGAGAATCCGATTTATGCGGACGTTGCAGATTATAATGTAACAGCC
GTCAATGCTGCCACGTTGCCACATGTTATTGACGAAGCAATTCGACGCGCCTATGCGCAC
CAAGGTGTTGCGGTTGTGCAAATTCCAGTCGATTTACCATGGCAACAGATTCCAGCTGAA
GATTGGTATGCTTCCGCTAATAGTTATCAAACGCCGTTATTACCAGAACCCGACGTTCAA
GCAGTGACGAGATTGACACAGACTTTACTCGCAGCTGAACGGCCACTTATTTACTATGGC
ATTGGAGCTCGTAAGGCTGGTAAAGAACTCGAACAATTGAGTAAAACGTTGAAAATTCCA
TTAATGAGTACGTATCCAGCTAAGGGGATTGTCGCAGATCGTTATCCAGCCTATTTGGGT
TCTGCTAATCGGGTGGCACAAAAACCGGCGAATGAGGCACTTGCGCAAGCTGACGTTGTT
TTATTTGTTGGTAATAATTATCCGTTTGCAGAAGTTTCCAAAGCGTTTAAAAATACGCGT
TATTTCTTACAAATTGATATTGATCCGGCTAAGTTAGGTAAACGACATAAAACAGATATT
GCGGTACTTGCTGATGCACAAAAGACGCTGGCTGCAATTTTAGCACAGGTATCTGAACGG
GAGTCGACACCTTGGTGGCAAGCCAATTTAGCCAATGTTAAAAATTGGCGGGCTTATCTA
GCTTCATTAGAAGATAAGCAGGAAGGGCCTTTACAAGCATATCAAGTGCTACGTGCGGTT
AATAAAATTGCGGAGCCTGATGCAATCTATTCGATTGATGTTGGTGATATCAATTTGAAT
GCGAATCGACATTTGAAATTAACGCCATCCAATCGGCACATTACTTCTAACTTATTTGCT
ACGATGGGAGTTGGTATTCCGGGAGCAATTGCTGCCAAACTTAATTATCCTGAGCGGCAG
GTGTTTAATCTGGCTGGTGATGGTGGCGCTTCGATGACCATGCAAGATTTGGCGACGCAA
GTTCAATACCATTTACCAGTGATTAATGTTGTTTTCACCAACTGCCAATATGGATTTATC
AAAGATGAGCAGGAAGATACTAATCAGAATGATTTTATTGGCGTTGAATTCAATGATATT
GATTTTAGTAAGATTGCCGATGGCGTGCACATGCAAGCTTTTCGAGTTAATAAGATTGAG
CAATTACCTGATGTTTTTGAACAAGCCAAAGCAATCGCTCAGCATGAACCAGTTCTGATT
GATGCGGTGATTACAGGAGATCGGCCACTGCCTGCTGAAAAGCTTCGTTTAGATTCGGCA
ACGAGTTCGGCAGCTGATATTGAAGCATTTAAACAACGGTATGAAGCTCAAGATTTACAA
CCACTTTCAACTTATTTAAAACAATTTGGCTTAGATGATTTGCAACATCAAATTGGACAG
GGTGGGTTTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP37063
UniProtKB Entry NamePOXB_LACPL
GenBank Protein ID28272737
GenBank Gene IDAL935262
General References
  1. Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM, Fiers MW, Stiekema W, Lankhorst RM, Bron PA, Hoffer SM, Groot MN, Kerkhoven R, de Vries M, Ursing B, de Vos WM, Siezen RJ: Complete genome sequence of Lactobacillus plantarum WCFS1. Proc Natl Acad Sci U S A. 2003 Feb 18;100(4):1990-5. Epub 2003 Feb 3. [PubMed:12566566]
  2. Muller YA, Schumacher G, Rudolph R, Schulz GE: The refined structures of a stabilized mutant and of wild-type pyruvate oxidase from Lactobacillus plantarum. J Mol Biol. 1994 Apr 1;237(3):315-35. [PubMed:8145244]
  3. Muller YA, Schulz GE: Structure of the thiamine- and flavin-dependent enzyme pyruvate oxidase. Science. 1993 Feb 12;259(5097):965-7. doi: 10.1126/science.8438155. [PubMed:8438155]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB01987Cocarboxylaseapproved, experimentalunknownDetails