Peptidoglycan synthase FtsI

Details

Name
Peptidoglycan synthase FtsI
Synonyms
  • 2.4.1.129
  • PBP-3
  • Penicillin-binding protein 3
  • Peptidoglycan glycosyltransferase 3
Gene Name
ftsI
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Amino acid sequence
>lcl|BSEQ0009865|Peptidoglycan synthase FtsI
MVKFNSSRKSGKSKKTIRKLTAPETVKQNKPQKVFEKCFMRGRYMLSTVLILLGLCALVA
RAAYVQSINADTLSNEADKRSLRKDEVLSVRGSILDRNGQLLSVSVPMSAIVADPKTMLK
ENSLADKERIAALAEELGMTENDLVKKIEKNSKSGYLYLARQVELSKANYIRRLKIKGII
LETEHRRFYPRVEEAAHVVGYTDIDGNGIEGIEKSFNSLLVGKDGSRTVRKDKRGNIVAH
ISDEKKYDAQDVTLSIDEKLQSMVYREIKKAVSENNAESGTAVLVDVRTGEVLAMATAPS
YNPNNRVGVKSELMRNRAITDTFEPGSTVKPFVVLTALQRGVVKRDEIIDTTSFKLSGKE
IVDVAPRAQQTLDEILMNSSNRGVSRLALRMPPSALMETYQNAGLSKPTDLGLIGEQVGI
LNANRKRWADIERATVAYGYGITATPLQIARAYATLGSFGVYRPLSITKVDPPVIGKRVF
SEKITKDIVGILEKVAIKNKRAMVEGYRVGVKTGTARKIENGHYVNKYVAFTAGIAPISD
PRYALVVLINDPKAGEYYGGAVSAPVFSNIMGYALRANAIPQDAEAAENTTTKSAKRIVY
IGEHKNQKVN
Number of residues
610
Molecular Weight
67165.845
Theoretical pI
10.24
GO Classification
Functions
penicillin binding / peptidoglycan glycosyltransferase activity
Processes
cell cycle / cell division / cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape
Components
integral component of membrane / plasma membrane
General Function
Peptidoglycan glycosyltransferase activity
Specific Function
Essential cell division protein that is required for the synthesis of peptidoglycan at the division septum. Catalyzes the synthesis of cross-linked peptidoglycan from the lipid-linked precursors.
Pfam Domain Function
Transmembrane Regions
43-65
Cellular Location
Cell inner membrane
Gene sequence
>lcl|BSEQ0009866|Peptidoglycan synthase FtsI (ftsI)
ATGGTGAAATTTAATTCCTCGCGTAAATCAGGTAAGTCAAAAAAAACAATTAGAAAATTG
ACCGCACCTGAAACTGTAAAGCAAAACAAGCCTCAAAAGGTGTTTGAAAAATGCTTTATG
CGTGGACGTTATATGCTTTCTACGGTTCTTATTTTACTTGGCCTGTGTGCTTTAGTCGCA
CGAGCAGCTTATGTTCAATCTATTAATGCCGATACGTTATCGAATGAAGCGGATAAGCGT
TCTTTGCGTAAAGATGAAGTATTATCGGTGCGTGGTTCTATTTTAGATCGTAATGGTCAG
CTTTTATCTGTAAGCGTGCCGATGAGCGCGATTGTGGCAGATCCAAAAACGATGTTGAAG
GAAAATTCGCTTGCGGATAAAGAACGAATTGCAGCTTTAGCCGAAGAATTAGGTATGACT
GAAAATGATTTAGTGAAAAAAATTGAGAAAAATTCTAAATCTGGTTATTTGTATTTAGCA
CGTCAAGTTGAATTAAGTAAAGCTAACTATATTCGTAGATTAAAAATTAAGGGTATTATT
TTAGAAACAGAGCATCGCCGTTTTTATCCTCGTGTAGAAGAAGCTGCACACGTGGTGGGT
TATACGGATATTGATGGAAATGGTATTGAAGGCATTGAGAAAAGTTTTAATTCCCTGCTT
GTTGGTAAAGACGGTTCACGTACTGTTCGTAAAGATAAACGTGGGAATATTGTTGCACAT
ATCTCCGATGAGAAAAAATATGATGCACAAGATGTTACCTTAAGTATCGATGAAAAATTG
CAATCTATGGTGTATCGTGAGATTAAAAAGGCGGTGTCTGAGAATAATGCTGAGTCTGGT
ACTGCGGTGTTAGTTGATGTTCGAACAGGGGAAGTGTTAGCTATGGCGACTGCGCCCTCT
TATAATCCAAACAACCGTGTCGGCGTGAAATCAGAGTTAATGCGTAACCGTGCAATTACC
GATACTTTTGAGCCAGGTTCTACGGTAAAACCTTTCGTTGTTTTAACCGCACTTCAACGA
GGTGTAGTTAAACGAGATGAAATTATTGATACTACGTCCTTTAAATTAAGCGGTAAAGAA
ATTGTGGACGTTGCACCACGTGCTCAGCAAACTTTAGACGAGATTTTAATGAACTCTAGT
AACCGTGGTGTAAGTCGTCTTGCATTACGTATGCCACCTAGTGCATTAATGGAAACTTAT
CAAAATGCAGGTTTAAGTAAACCGACAGATTTAGGCTTGATCGGAGAGCAAGTTGGGATT
TTGAATGCAAATCGTAAACGCTGGGCAGATATTGAGCGTGCAACAGTCGCTTATGGTTAT
GGTATTACTGCGACACCTTTACAAATTGCTCGTGCCTATGCAACCCTTGGTAGTTTCGGT
GTTTATCGTCCGCTTTCTATCACTAAAGTTGATCCGCCAGTTATTGGGAAACGGGTTTTC
TCTGAAAAAATAACTAAAGATATTGTGGGAATTTTAGAGAAAGTAGCAATTAAAAATAAA
CGCGCAATGGTGGAAGGCTACCGTGTCGGCGTAAAAACAGGTACGGCACGTAAGATTGAA
AATGGACATTATGTAAATAAGTATGTGGCATTTACTGCGGGTATTGCACCAATTAGTGAT
CCTCGTTATGCATTAGTGGTTTTGATCAATGATCCAAAAGCAGGAGAATATTATGGTGGT
GCGGTTTCTGCCCCTGTATTCTCTAACATTATGGGCTATGCGTTACGTGCAAATGCTATT
CCGCAAGATGCTGAAGCAGCTGAAAACACAACAACGAAAAGTGCAAAACGTATTGTTTAT
ATTGGCGAACACAAGAATCAAAAAGTGAATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP45059
UniProtKB Entry NameFTSI_HAEIN
GenBank Protein ID1574687
GenBank Gene IDL42023
General References
  1. Fleischmann RD, Adams MD, White O, Clayton RA, Kirkness EF, Kerlavage AR, Bult CJ, Tomb JF, Dougherty BA, Merrick JM, et al.: Whole-genome random sequencing and assembly of Haemophilus influenzae Rd. Science. 1995 Jul 28;269(5223):496-512. [PubMed:7542800]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00303Ertapenemapproved, investigationalyesinhibitorDetails