Outer-membrane lipoprotein LolB
Details
- Name
- Outer-membrane lipoprotein LolB
- Synonyms
- hemM
- ychC
- Gene Name
- lolB
- UniProtKB Entry
- P61320Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0012997|Outer-membrane lipoprotein LolB MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAY ISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEE MIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKT QPAMPANMELTDGGQRIKLKMDNWIVK
- Number of residues
- 207
- Molecular Weight
- 23550.63
- Theoretical pI
- 9.19
- GO Classification
- Functionslipopeptide bindingProcesseslipid localization / lipoprotein localization to outer membrane / lipoprotein metabolic process / localization within membrane / protein transportComponentscell outer membrane
- General Function
- Plays a critical role in the incorporation of lipoproteins in the outer membrane after they are released by the LolA protein. Essential for E.coli viability.
- Specific Function
- Lipopeptide binding
- Pfam Domain Function
- LolB (PF03550)
- Signal Regions
- 1-21
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell outer membrane
- Gene sequence
>lcl|BSEQ0012998|Outer-membrane lipoprotein LolB (lolB) ATGCCCCTGCCCGATTTTCGTCTTATCCGCCTGCTACCGCTGGCTGCTCTTGTGCTCACT GCCTGTTCCGTTACCACGCCCAAAGGTCCTGGCAAAAGCCCGGATTCGCCACAATGGCGT CAGCATCAGCAAGACGTGCGCAATCTTAATCAGTATCAGACTCGCGGCGCGTTCGCTTAT ATTTCTGACCAACAAAAAGTGTACGCCCGCTTTTTCTGGCAGCAAACCGGCCAGGATCGC TACCGTCTGCTGCTCACTAACCCATTGGGCAGCACGGAACTGGAGCTGAATGCTCAACCG GGTAACGTGCAGTTAGTCGACAATAAAGGTCAGCGTTATACCGCCGATGACGCCGAAGAG ATGATTGGCAAATTGACCGGAATGCCAATTCCGCTCAACAGCTTGCGCCAGTGGATTTTA GGTTTACCGGGTGATGCAACCGACTACAAACTGGACGACCAGTACCGCCTGAGCGAAATT ACCTACAGCCAGAATGGCAAAAACTGGAAGGTTGTTTATGGTGGTTATGACACCAAAACG CAACCTGCGATGCCAGCCAATATGGAACTCACCGACGGTGGTCAACGCATCAAGTTAAAA ATGGATAACTGGATAGTGAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P61320 UniProtKB Entry Name LOLB_ECOLI GenBank Protein ID 290462 GenBank Gene ID M77237 PDB ID(s) 1IWM, 1IWN KEGG ID ecj:JW1200 NCBI Gene ID 945775 - General References
- Ikemi M, Murakami K, Hashimoto M, Murooka Y: Cloning and characterization of genes involved in the biosynthesis of delta-aminolevulinic acid in Escherichia coli. Gene. 1992 Nov 2;121(1):127-32. [Article]
- Post DA, Hove-Jensen B, Switzer RL: Characterization of the hemA-prs region of the Escherichia coli and Salmonella typhimurium chromosomes: identification of two open reading frames and implications for prs expression. J Gen Microbiol. 1993 Feb;139(2):259-66. [Article]
- Strohmaier H, Remler P, Renner W, Hogenauer G: Expression of genes kdsA and kdsB involved in 3-deoxy-D-manno-octulosonic acid metabolism and biosynthesis of enterobacterial lipopolysaccharide is growth phase regulated primarily at the transcriptional level in Escherichia coli K-12. J Bacteriol. 1995 Aug;177(15):4488-500. [Article]
- Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Matsuyama Si, Yokota N, Tokuda H: A novel outer membrane lipoprotein, LolB (HemM), involved in the LolA (p20)-dependent localization of lipoproteins to the outer membrane of Escherichia coli. EMBO J. 1997 Dec 1;16(23):6947-55. [Article]
- Tanaka K, Matsuyama SI, Tokuda H: Deletion of lolB, encoding an outer membrane lipoprotein, is lethal for Escherichia coli and causes accumulation of lipoprotein localization intermediates in the periplasm. J Bacteriol. 2001 Nov;183(22):6538-42. [Article]
- Takeda K, Miyatake H, Yokota N, Matsuyama S, Tokuda H, Miki K: Crystal structures of bacterial lipoprotein localization factors, LolA and LolB. EMBO J. 2003 Jul 1;22(13):3199-209. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Outer-membrane lipoprotein LolB (Escherichia coli (strain K12)) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Triglyme experimental unknown target Details