Glutamate receptor ionotropic, kainate 4

Details

Name
Glutamate receptor ionotropic, kainate 4
Synonyms
  • EAA1
  • Excitatory amino acid receptor 1
  • GluK4
  • Glutamate receptor KA-1
  • GRIK
  • KA1
Gene Name
GRIK4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010583|Glutamate receptor ionotropic, kainate 4
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Number of residues
956
Molecular Weight
107244.485
Theoretical pI
6.71
GO Classification
Functions
extracellular-glutamate-gated ion channel activity / kainate selective glutamate receptor activity
Processes
glutamate receptor signaling pathway / ion transmembrane transport / ionotropic glutamate receptor signaling pathway / synaptic transmission / synaptic transmission, glutamatergic / transport
Components
cell junction / dendrite / integral component of plasma membrane / kainate selective glutamate receptor complex / plasma membrane / postsynaptic membrane / presynaptic membrane
General Function
Kainate selective glutamate receptor activity
Specific Function
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Pfam Domain Function
Transmembrane Regions
546-566 624-644 805-825
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010584|Glutamate receptor ionotropic, kainate 4 (GRIK4)
ATGCCCCGCGTCTCGGCGCCTTTGGTGCTGCTTCCTGCGTGGCTCGTGATGGTCGCCTGC
AGCCCGCACTCCTTGAGGATCGCTGCTATCTTGGACGACCCCATGGAGTGCAGCAGAGGG
GAGCGGCTCTCCATCACCCTGGCCAAGAACCGCATCAACCGCGCTCCTGAGAGGCTGGGC
AAGGCCAAGGTCGAAGTGGACATCTTTGAGCTTCTCAGAGACAGCGAGTACGAGACTGCA
GAAACCATGTGTCAGATCCTCCCCAAGGGGGTGGTCGCTGTCCTCGGACCATCGTCCAGC
CCAGCCTCCAGCTCCATCATCAGCAACATCTGTGGAGAGAAGGAGGTCCCTCACTTCAAA
GTGGCCCCAGAGGAGTTCGTCAAGTTCCAGTTCCAGAGATTCACAACCCTGAACCTCCAC
CCCAGCAACACTGACATCAGCGTGGCTGTAGCTGGGATCCTGAACTTCTTCAACTGCACC
ACCGCCTGCCTCATCTGTGCCAAAGCAGAATGCCTTTTAAACCTAGAGAAGCTGCTCCGG
CAATTCCTTATCTCCAAGGACACGCTGTCCGTCCGCATGCTGGATGACACCCGGGACCCC
ACCCCGCTCCTCAAGGAGATCCGGGACGACAAGACCGCCACCATCATCATCCACGCCAAC
GCCTCCATGTCCCACACCATCCTCCTGAAGGCAGCCGAACTTGGGATGGTGTCAGCCTAT
TACACATACATCTTCACTAATCTGGAGTTCTCACTCCAGAGAATGGACAGCCTTGTGGAT
GATCGTGTCAACATCCTGGGATTTTCCATTTTCAACCAATCCCATGCTTTCTTCCAAGAG
TTTGCCCAGAGCCTCAACCAGTCCTGGCAGGAGAACTGTGACCATGTGCCCTTCACTGGG
CCTGCGCTCTCCTCGGCCCTGCTGTTTGATGCTGTCTATGCTGTGGTGACTGCGGTGCAG
GAACTGAACCGGAGCCAAGAGATCGGCGTGAAGCCCTTGTCCTGCGGCTCGGCCCAGATC
TGGCAGCACGGCACCAGCCTCATGAACTACCTGCGCATGGTAGAATTGGAAGGTCTTACC
GGCCACATTGAATTCAACAGCAAAGGCCAGAGGTCCAACTACGCTTTGAAAATCTTACAG
TTCACAAGGAATGGTTTTCGGCAGATCGGCCAGTGGCACGTGGCAGAGGGCCTCAGCATG
GACAGCCACCTCTATGCCTCCAACATCTCGGACACTCTCTTCAACACCACCCTGGTCGTC
ACCACCATCCTGGAGAACCCATATTTAATGCTGAAGGGGAACCACCAGGAGATGGAAGGC
AATGACCGCTACGAGGGCTTCTGTGTGGACATGCTCAAGGAGCTGGCAGAGATCCTCCGA
TTCAACTACAAGATCCGCCTGGTTGGGGATGGCGTGTACGGCGTTCCCGAGGCCAACGGC
ACCTGGACGGGAATGGTCGGGGAGCTGATCGCTAGGAAAGCAGATCTGGCTGTGGCAGGC
CTCACCATTACAGCTGAACGGGAGAAGGTGATTGATTTCTCTAAGCCATTCATGACTCTG
GGAATTAGCATTCTTTACCGCGTTCATATGGGACGCAAACCCGGCTATTTCTCCTTCCTG
GACCCATTTTCTCCGGGCGTCTGGCTCTTCATGCTTCTAGCCTATCTGGCCGTCAGCTGT
GTCCTCTTCCTGGTGGCTCGGTTGACGCCCTACGAGTGGTACAGCCCACACCCATGTGCC
CAGGGCCGGTGCAACCTCCTGGTGAACCAGTACTCCCTGGGCAACAGCCTCTGGTTTCCG
GTCGGGGGGTTCATGCAGCAAGGCTCCACCATCGCCCCTCGCGCCTTATCCACCCGCTGT
GTCAGTGGCGTCTGGTGGGCATTCACGCTGATCATCATCTCATCCTACACGGCCAACCTG
GCAGCCTTCCTGACCGTGCAGCGCATGGATGTGCCCATTGAGTCAGTGGATGACCTGGCT
GACCAGACCGCCATTGAATATGGCACAATTCACGGAGGCTCCAGCATGACCTTCTTCCAA
AATTCCCGCTACCAGACCTACCAACGCATGTGGAATTACATGTATTCCAAGCAGCCCAGC
GTGTTCGTGAAGAGCACAGAGGAGGGAATCGCCAGGGTGTTGAATTCCAACTACGCCTTC
CTCCTGGAATCCACCATGAACGAGTACTATCGGCAGCGAAACTGCAACCTCACTCAGATT
GGGGGCCTGCTGGACACCAAGGGCTATGGGATTGGCATGCCAGTCGGCTCGGTTTTCCGG
GACGAGTTTGATCTGGCCATTCTCCAGCTGCAGGAGAACAACCGCCTGGAGATCCTGAAG
CGCAAATGGTGGGAAGGAGGGAAGTGCCCCAAGGAGGAAGATCACAGAGCTAAAGGCCTG
GGAATGGAGAATATTGGTGGAATCTTTGTGGTTCTTATTTGTGGCTTAATCGTGGCCATT
TTTATGGCTATGTTGGAGTTTTTATGGACTCTCAGACACTCAGAAGCAACTGAGGTGTCC
GTCTGCCAGGAGATGGTGACCGAGCTGCGCAGCATTATCCTGTGTCAGGACAGTATCCAC
CCCCGCCGGCGGCGCGCCGCAGTCCCGCCGCCCCGGCCCCCCATCCCCGAGGAGCGCCGA
CCGCGGGGCACGGCGACGCTCAGCAACGGGAAGCTGTGCGGGGCAGGGGAGCCCGACCAG
CTCGCGCAGAGACTGGCGCAGGAGGCCGCCCTGGTGGCCCGCGGCTGCACGCACATCCGC
GTCTGCCCCGAGTGCCGCCGCTTCCAGGGCCTGCGGGCACGGCCGTCGCCCGCCCGCAGC
GAGGAGAGCCTGGAGTGGGAGAAAACCACCAACAGCAGCGAGCCCGAGTAG
Chromosome Location
11
Locus
11q22.3
External Identifiers
ResourceLink
UniProtKB IDQ16099
UniProtKB Entry NameGRIK4_HUMAN
GenBank Protein ID544590
GenBank Gene IDS67803
GenAtlas IDGRIK4
HGNC IDHGNC:4582
General References
  1. Kamboj RK, Schoepp DD, Nutt S, Shekter L, Korczak B, True RA, Rampersad V, Zimmerman DM, Wosnick MA: Molecular cloning, expression, and pharmacological characterization of humEAA1, a human kainate receptor subunit. J Neurochem. 1994 Jan;62(1):1-9. [PubMed:8263508]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00142Glutamic acidapproved, nutraceuticalunknownDetails
DB00237Butabarbitalapproved, illicitunknownantagonistDetails
DB00273TopiramateapprovedyesantagonistDetails