Beta-xylanase

Details

Name
Beta-xylanase
Synonyms
  • 3.2.1.8
Gene Name
Not Available
Organism
Streptomyces olivaceoviridis
Amino acid sequence
>lcl|BSEQ0012149|Beta-xylanase
AESTLGAAAAQSGRYFGTAIASGKLGDSAYTTIASREFNMVTAENEMKIDATEPQRGQFN
FSAGDRVYNWAVQNGKQVRGHTLAWHSQQPGWMQSLSGSTLRQAMIDHINGVMGHYKGKI
AQWDVVNEAFSDDGSGGRRDSNLQRTGNDWIEVAFRTARAADPAAKLCYNDYNIENWTWA
KTQGVYNMVRDFKQRGVPIDCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQ
GASSSTYAAVTNDCLAVSRCLGITVWGVRDTDSWRSGDTPLLFNGDGSKKAAYTAVLNAL
NGGSSTPPPSGGGQIKGVGSGRCLDVPNASTTDGTQVQLYDCHSATNQQWTYTDAGELRV
YGDKCLDAAGTGNGTKVQIYSCWGGDNQKWRLNSDGSIVGVQSGLCLDAVGGGTANGTLI
QLYSCSNGSNQRWTRT
Number of residues
436
Molecular Weight
46749.175
Theoretical pI
6.5
GO Classification
Functions
endo-1,4-beta-xylanase activity
Processes
polysaccharide catabolic process
General Function
Endo-1,4-beta-xylanase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ7SI98
UniProtKB Entry NameQ7SI98_STROI
General References
  1. Fujimoto Z, Kuno A, Kaneko S, Yoshida S, Kobayashi H, Kusakabe I, Mizuno H: Crystal structure of Streptomyces olivaceoviridis E-86 beta-xylanase containing xylan-binding domain. J Mol Biol. 2000 Jul 14;300(3):575-85. [PubMed:10884353]
  2. Fujimoto Z, Kuno A, Kaneko S, Kobayashi H, Kusakabe I, Mizuno H: Crystal structures of the sugar complexes of Streptomyces olivaceoviridis E-86 xylanase: sugar binding structure of the family 13 carbohydrate binding module. J Mol Biol. 2002 Feb 8;316(1):65-78. [PubMed:11829503]
  3. Fujimoto Z, Kaneko S, Kuno A, Kobayashi H, Kusakabe I, Mizuno H: Crystal structures of decorated xylooligosaccharides bound to a family 10 xylanase from Streptomyces olivaceoviridis E-86. J Biol Chem. 2004 Mar 5;279(10):9606-14. Epub 2003 Dec 11. [PubMed:14670957]
  4. Kaneko S, Ichinose H, Fujimoto Z, Kuno A, Yura K, Go M, Mizuno H, Kusakabe I, Kobayashi H: Structure and function of a family 10 beta-xylanase chimera of Streptomyces olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex. J Biol Chem. 2004 Jun 18;279(25):26619-26. Epub 2004 Apr 12. [PubMed:15078885]
  5. Suzuki R, Fujimoto Z, Ito S, Kawahara S, Kaneko S, Taira K, Hasegawa T, Kuno A: Crystallographic snapshots of an entire reaction cycle for a retaining xylanase from Streptomyces olivaceoviridis E-86. J Biochem. 2009 Jul;146(1):61-70. doi: 10.1093/jb/mvp047. Epub 2009 Mar 11. [PubMed:19279191]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03389alpha-D-XylopyranoseexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB04465Lactoseapproved, experimental, investigationalunknownDetails