Cation channel sperm-associated protein 1

Details

Name
Cation channel sperm-associated protein 1
Synonyms
  • CatSper1
Gene Name
CATSPER1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049531|Cation channel sperm-associated protein 1
MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHP
PEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQ
RDGRRHHDGSQYGGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYL
PHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKS
PHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYH
QHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSA
HSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTN
LFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFVVCLNTVMLVAQTFAEVEIRGEWYF
MALDSIFFCIYVVEALLKIIALGLSYFFDFWNNLDFFIMAMAVLDFLLMQTHSFAIYHQS
LFRILKVFKSLRALRAIRVLRRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAV
LRALFRKSDPKRFQNIFTTIFTLFTLLTLDDWSLIYMDSRAQGAWYIIPILVIYIIIQYF
IFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLEDSLTELRAAEPKEVASEGTML
KRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAVIDEIVDTTFEAGEEDFRN
Number of residues
780
Molecular Weight
90090.225
Theoretical pI
Not Available
GO Classification
Functions
calcium activated cation channel activity / high voltage-gated calcium channel activity
Processes
cell differentiation / flagellated sperm motility / fusion of sperm to egg plasma membrane / membrane depolarization during action potential / multicellular organism development / regulation of calcium ion transport / regulation of cilium beat frequency involved in ciliary motility / response to progesterone / sperm-egg recognition / spermatogenesis
Components
CatSper complex / motile cilium / plasma membrane
General Function
Voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte.
Specific Function
Calcium activated cation channel activity
Pfam Domain Function
Transmembrane Regions
446-466 486-506 516-536 542-562 580-600 647-667
Cellular Location
Cell projection
Gene sequence
>lcl|BSEQ0049532|Cation channel sperm-associated protein 1 (CATSPER1)
ATGGATCAAAACTCAGTGCCTGAAAAGGCTCAGAATGAGGCAGACACCAATAACGCAGAT
AGGTTCTTTCGCTCTCACTCATCACCCCCACACCACAGGCCAGGCCACAGCAGAGCTCTC
CACCATTACGAGTTGCACCATCACGGCGTGCCCCACCAACGTGGTGAATCTCACCACCCT
CCGGAGTTCCAAGACTTCCACGACCAAGCCTTGTCCTCCCATGTCCACCAATCTCACCAC
CACAGCGAGGCACGGAATCACGGCAGAGCCCATGGCCCCACAGGCTTTGGTCTGGCTCCC
TCTCAAGGCGCCGTCCCCTCCCACCGTTCCTACGGTGAGGACTACCATGATGAGCTCCAA
CGTGATGGCAGGAGGCATCATGATGGGTCCCAATACGGTGGGTTCCATCAGCAGAGTGAC
TCCCATTACCATAGGGGGTCTCACCATGGCAGACCCCAATATCTCGGTGAGAATTTATCC
CACTATTCCTCTGGCGTGCCCCACCACGGTGAGGCTTCCCACCATGGTGGGTCCTACCTC
CCCCATGGACCCAATCCCTACAGTGAGTCCTTCCACCACAGCGAGGCTTCCCACCTTAGC
GGGCTCCAACACGATGAGTCCCAGCATCACCAAGTCCCCCACCGTGGCTGGCCCCACCAT
CACCAAGTCCACCACCATGGCAGGTCCCGTCATCATGAAGCCCACCAGCATGGAAAGTCT
CCTCATCACGGAGAGACCATTTCCCCTCATTCCTCTGTGGGGTCCTACCAGCGTGGGATA
TCTGACTATCACAGCGAGTACCACCAAGGTGATCACCACCCCAGTGAGTACCACCATGGC
GACCATCCCCACCACACACAGCACCACTACCACCAGACCCACCGGCACCGAGACTACCAT
CAGCACCAAGACCACCACGGCGCGTATCATTCCAGTTACCTCCATGGCGACTACGTCCAG
AGCACTTCCCAACTCTCTATCCCACACACATCCCGGAGCCTGATTCACGATGCCCCCGGC
CCTGCTGCTTCTCGTACAGGAGTCTTCCCCTATCACGTAGCACACCCACGGGGCTCGGCT
CACAGCATGACTCGGTCCTCCAGCACAATCCGCTCACGTGTCACCCAGATGTCCAAAAAA
GTCCATACCCAGGATATCTCCACCAAACATTCAGAAGACTGGGGCAAAGAAGAAGGGCAA
TTTCAGAAACGCAAAACCGGCCGGCTCCAGCGGACCCGCAAGAAGGGACACTCTACCAAT
CTCTTCCAGTGGCTGTGGGAAAAGCTAACCTTCCTCATTCAGGGCTTCCGGGAAATGATC
CGGAACCTGACCCAATCCTTGGCCTTTGAAACTTTCATCTTCTTCGTTGTCTGCCTCAAC
ACCGTCATGCTGGTGGCCCAGACCTTCGCTGAAGTCGAGATCCGGGGCGAGTGGTACTTC
ATGGCCTTGGACTCCATATTCTTCTGCATCTACGTGGTGGAAGCCCTGCTCAAGATCATC
GCCCTGGGCCTCTCGTACTTCTTTGACTTCTGGAACAATTTGGACTTCTTCATTATGGCC
ATGGCCGTGCTGGACTTCTTGCTGATGCAGACCCACTCCTTCGCCATCTACCACCAAAGC
CTCTTCCGGATCCTCAAGGTCTTCAAGAGCCTGCGGGCCCTGAGGGCAATCCGGGTCCTG
CGGAGGCTCAGCTTCCTGACCAGCGTCCAGGAAGTGACAGGGACCCTGGGCCAGTCCTTG
CCGTCCATCGCAGCCATCCTCATCCTCATGTTTACCTGCCTCTTCCTCTTCTCCGCGGTC
CTCCGGGCACTGTTCCGCAAATCTGACCCCAAGCGCTTCCAGAACATCTTCACCACCATC
TTCACCCTCTTCACCTTGCTCACGCTGGATGACTGGTCCCTCATCTACATGGACAGCCGT
GCCCAGGGCGCCTGGTACATCATTCCCATCCTCGTAATTTACATCATCATCCAGTACTTC
ATCTTCCTCAACCTGGTGATTACTGTCCTGGTGGATAGCTTCCAGACGGCGCTGTTCAAA
GGCCTTGAGAAAGCGAAGCAGGAGAGGGCCGCCCGGATCCAAGAGAAGCTGCTGGAAGAC
TCACTGACGGAGCTCAGAGCTGCAGAGCCCAAAGAGGTGGCGAGTGAAGGCACCATGCTG
AAGCGGCTCATCGAGAAAAAGTTTGGGACCATGACTGAGAAGCAGCAGGAGCTCCTGTTC
CATTACCTGCAGCTGGTGGCAAGCGTGGAGCAGGAGCAGCAGAAGTTCCGCTCCCAGGCA
GCCGTCATCGATGAGATTGTGGACACCACATTTGAGGCTGGAGAAGAGGACTTCAGGAAT
TGA
Chromosome Location
11
Locus
11q13.1
External Identifiers
ResourceLink
UniProtKB IDQ8NEC5
UniProtKB Entry NameCTSR1_HUMAN
HGNC IDHGNC:17116
General References
  1. Ren D, Navarro B, Perez G, Jackson AC, Hsu S, Shi Q, Tilly JL, Clapham DE: A sperm ion channel required for sperm motility and male fertility. Nature. 2001 Oct 11;413(6856):603-9. [Article]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Nikpoor P, Mowla SJ, Movahedin M, Ziaee SA, Tiraihi T: CatSper gene expression in postnatal development of mouse testis and in subfertile men with deficient sperm motility. Hum Reprod. 2004 Jan;19(1):124-8. [Article]
  5. Li HG, Liao AH, Ding XF, Zhou H, Xiong CL: The expression and significance of CATSPER1 in human testis and ejaculated spermatozoa. Asian J Androl. 2006 May;8(3):301-6. [Article]
  6. Zhang D, Chen J, Saraf A, Cassar S, Han P, Rogers JC, Brioni JD, Sullivan JP, Gopalakrishnan M: Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity. J Biol Chem. 2006 Aug 4;281(31):22332-41. Epub 2006 Jun 1. [Article]
  7. Li HG, Ding XF, Liao AH, Kong XB, Xiong CL: Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility. Mol Hum Reprod. 2007 May;13(5):299-306. Epub 2007 Mar 8. [Article]
  8. Avenarius MR, Hildebrand MS, Zhang Y, Meyer NC, Smith LL, Kahrizi K, Najmabadi H, Smith RJ: Human male infertility caused by mutations in the CATSPER1 channel protein. Am J Hum Genet. 2009 Apr;84(4):505-10. doi: 10.1016/j.ajhg.2009.03.004. Epub 2009 Apr 2. [Article]
  9. Strunker T, Goodwin N, Brenker C, Kashikar ND, Weyand I, Seifert R, Kaupp UB: The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm. Nature. 2011 Mar 17;471(7338):382-6. doi: 10.1038/nature09769. [Article]
  10. Lishko PV, Botchkina IL, Kirichok Y: Progesterone activates the principal Ca2+ channel of human sperm. Nature. 2011 Mar 17;471(7338):387-91. doi: 10.1038/nature09767. [Article]
  11. Miller MR, Mannowetz N, Iavarone AT, Safavi R, Gracheva EO, Smith JF, Hill RZ, Bautista DM, Kirichok Y, Lishko PV: Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone. Science. 2016 Apr 29;352(6285):555-9. doi: 10.1126/science.aad6887. Epub 2016 Mar 17. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB11093Calcium citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails