Pannexin-1

Details

Name
Pannexin-1
Synonyms
  • MRS1
Gene Name
PANX1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037257|Pannexin-1
MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI
GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILL
YLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLG
QSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSL
SDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFR
QKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQG
IDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQR
LLDSSC
Number of residues
426
Molecular Weight
48049.555
Theoretical pI
6.07
GO Classification
Functions
calcium channel activity / gap junction hemi-channel activity / leak channel activity / receptor binding
Processes
calcium ion transport / cation transport / cell-cell signaling / innate immune response / nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway / positive regulation of interleukin-1 alpha secretion / positive regulation of interleukin-1 beta secretion / protein hexamerization / response to ATP / response to ischemia / synaptic transmission
Components
bleb / endoplasmic reticulum / endoplasmic reticulum membrane / gap junction / integral component of membrane / membrane / plasma membrane / protein complex
General Function
Receptor binding
Specific Function
Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis.
Pfam Domain Function
Transmembrane Regions
41-61 107-127 218-238 267-287
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021370|Pannexin-1 (PANX1)
ATGGCCATCGCTCAACTGGCCACGGAGTACGTGTTCTCGGATTTCTTGCTGAAGGAGCCC
ACGGAGCCCAAGTTCAAGGGGCTGCGACTGGAGCTGGCTGTGGACAAGATGGTCACGTGC
ATTGCGGTGGGGCTGCCCCTGCTGCTCATCTCGCTGGCCTTCGCGCAGGAGATCTCGATT
GGTACACAGATAAGCTGTTTCTCTCCAAGTTCTTTCTCCTGGCGTCAGGCTGCCTTTGTG
GATTCATATTGCTGGGCGGCTGTTCAGCAGAAGAACTCACTGCAGAGCGAGTCTGGAAAC
CTCCCACTGTGGCTGCATAAGTTTTTCCCCTACATCCTGCTGCTCTTTGCGATCCTCCTG
TACCTGCCCCCGCTGTTCTGGCGTTTCGCAGCTGCTCCTCATATTTGCTCAGACTTGAAG
TTTATCATGGAAGAACTTGACAAAGTTTACAACCGTGCAATTAAGGCTGCAAAGAGTGCG
CGTGACCTTGACATGAGAGATGGAGCCTGCTCAGTTCCAGGTGTTACCGAGAACTTAGGG
CAAAGTTTGTGGGAGGTATCTGAAAGCCACTTCAAGTACCCAATTGTGGAGCAGTACTTG
AAGACAAAGAAAAATTCTAATAATTTAATCATCAAGTACATTAGCTGCCGCCTGCTGACA
CTCATCATTATACTGTTAGCGTGTATCTACCTGGGCTATTACTTCAGCCTCTCCTCACTC
TCAGACGAGTTTGTGTGCAGCATCAAATCAGGGATCCTGAGAAACGACAGCACCGTGCCC
GATCAGTTTCAGTGCAAACTCATTGCCGTGGGCATCTTCCAGTTGCTCAGTGTCATTAAC
CTTGTGGTTTATGTCCTGCTGGCTCCCGTGGTTGTCTACACGCTGTTTGTTCCATTCCGA
CAGAAGACAGATGTTCTCAAAGTGTACGAAATCCTCCCCACTTTTGATGTTCTGCATTTC
AAATCTGAAGGGTACAACGATTTGAGCCTCTACAATCTCTTCTTGGAGGAAAATATAAGT
GAGGTCAAGTCATACAAGTGTCTTAAGGTACTGGAGAATATTAAGAGCAGTGGTCAGGGG
ATCGACCCAATGCTACTCCTGACAAACCTTGGCATGATCAAGATGGATGTTGTTGATGGC
AAAACTCCCATGTCTGCAGAGATGAGAGAGGAGCAGGGGAACCAGACGGCAGAGCTCCAA
GGTATGAACATAGACAGTGAAACTAAAGCAAATAATGGAGAGAAGAATGCCCGACAGAGA
CTTCTGGATTCTTCTTGCTGA
Chromosome Location
11
Locus
11q21
External Identifiers
ResourceLink
UniProtKB IDQ96RD7
UniProtKB Entry NamePANX1_HUMAN
GenBank Protein ID3661616
GenBank Gene IDAF093239
HGNC IDHGNC:8599
General References
  1. Baranova A, Ivanov D, Petrash N, Pestova A, Skoblov M, Kelmanson I, Shagin D, Nazarenko S, Geraymovych E, Litvin O, Tiunova A, Born TL, Usman N, Staroverov D, Lukyanov S, Panchin Y: The mammalian pannexin family is homologous to the invertebrate innexin gap junction proteins. Genomics. 2004 Apr;83(4):706-16. [PubMed:15028292]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309]
  3. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743]
  4. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Vanden Abeele F, Bidaux G, Gordienko D, Beck B, Panchin YV, Baranova AV, Ivanov DV, Skryma R, Prevarskaya N: Functional implications of calcium permeability of the channel formed by pannexin 1. J Cell Biol. 2006 Aug 14;174(4):535-46. [PubMed:16908669]
  7. Boassa D, Ambrosi C, Qiu F, Dahl G, Gaietta G, Sosinsky G: Pannexin1 channels contain a glycosylation site that targets the hexamer to the plasma membrane. J Biol Chem. 2007 Oct 26;282(43):31733-43. Epub 2007 Aug 22. [PubMed:17715132]
  8. Bunse S, Schmidt M, Prochnow N, Zoidl G, Dermietzel R: Intracellular cysteine 346 is essentially involved in regulating Panx1 channel activity. J Biol Chem. 2010 Dec 3;285(49):38444-52. doi: 10.1074/jbc.M110.101014. Epub 2010 Sep 9. [PubMed:20829356]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01032Probenecidapproved, investigationalunknownantagonistDetails