Serine/threonine-protein kinase 36

Details

Name
Serine/threonine-protein kinase 36
Synonyms
  • 2.7.11.1
  • Fused homolog
  • KIAA1278
Gene Name
STK36
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051654|Serine/threonine-protein kinase 36
MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRH
PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR
ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT
ADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKNFLQGLLTKDPR
QRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
ILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILAS
ELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEW
QHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLS
SLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFA
CTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGN
SRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISS
ALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYS
CCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLVFRLQNLPCGM
EKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRL
TPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEG
ELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLC
PSFLNQLRQAPHGSEFLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQV
CCYHLPLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQPLLTSD
LLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSVRAHTYRLLGHLLQHS
MALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQL
LGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSL
QQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM
Number of residues
1315
Molecular Weight
143993.57
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / metal ion binding / protein serine/threonine kinase activity / transcription factor binding
Processes
brain development / cilium assembly / epithelial cilium movement / positive regulation of hh target transcription factor activity / positive regulation of smoothened signaling pathway / post-embryonic development / protein phosphorylation / regulation of DNA binding transcription factor activity
Components
cytoplasm / cytosol / nucleus
General Function
Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors (PubMed:10806483). Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization (PubMed:10806483). GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur (PubMed:10806483). Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function (By similarity). Essential for construction of the central pair apparatus of motile cilia.
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0051655|Serine/threonine-protein kinase 36 (STK36)
ATGGAAAAGTACCACGTGTTGGAGATGATTGGAGAAGGCTCTTTTGGGAGGGTGTACAAG
GGTCGAAGAAAATACAGTGCTCAGGTCGTGGCCCTGAAGTTCATCCCAAAATTGGGGCGC
TCAGAGAAGGAGCTGAGGAATTTGCAACGAGAGATTGAAATAATGCGGGGTCTGCGGCAT
CCCAACATTGTGCATATGCTTGACAGCTTTGAAACTGATAAAGAGGTGGTGGTGGTGACA
GACTATGCTGAGGGAGAGCTCTTTCAGATCCTAGAAGATGACGGAAAACTTCCTGAAGAC
CAGGTTCAGGCCATTGCTGCCCAGTTGGTGTCAGCCCTGTACTATCTGCATTCCCACCGC
ATCCTACACCGAGATATGAAGCCTCAGAACATCCTCCTCGCCAAGGGTGGTGGCATCAAG
CTCTGTGACTTTGGATTTGCCCGGGCTATGAGCACCAATACAATGGTGCTGACATCCATC
AAAGGCACACCACTCTATATGTCTCCAGAGCTGGTGGAGGAGCGACCATACGACCACACA
GCGGACCTCTGGTCTGTTGGCTGCATACTATATGAACTGGCAGTAGGCACCCCTCCCTTC
TATGCTACAAGCATCTTTCAGCTGGTCAGCCTCATTCTCAAGGACCCTGTGCGCTGGCCC
TCAACCATCAGTCCCTGCTTTAAGAACTTCCTGCAGGGACTGCTCACCAAAGACCCACGG
CAGCGACTGTCCTGGCCAGACCTCTTATATCACCCCTTTATTGCTGGTCATGTCACCATA
ATAACTGAGCCAGCAGGCCCAGATTTGGGGACCCCATTCACCAGCCGCCTACCCCCAGAA
CTTCAGGTCCTAAAGGACGAACAGGCCCATCGGTTGGCCCCCAAGGGTAATCAGTCTCGC
ATCTTGACTCAGGCCTATAAACGCATGGCTGAGGAGGCCATGCAGAAGAAACATCAGAAC
ACAGGACCTGCCCTTGAGCAAGAGGACAAGACCAGCAAGGTGGCTCCTGGCACAGCCCCT
CTGCCCAGACTCGGGGCCACTCCTCAGGAATCAAGCCTCCTGGCCGGGATCTTAGCCTCA
GAATTGAAGAGCAGCTGGGCTAAATCAGGGACTGGAGAGGTGCCCTCTGCACCTCGGGAA
AACCGGACCACCCCAGATTGTGAACGAGCATTCCCAGAGGAGAGGCCAGAGGTGCTGGGC
CAGCGGAGCACTGATGTAGTGGACCTGGAAAATGAGGAGCCAGACAGTGACAATGAGTGG
CAGCACCTGCTAGAGACCACTGAGCCTGTGCCTATTCAACTGAAGGCTCCTCTCACCTTG
CTGTGTAATCCTGACTTCTGCCAGCGCATCCAGAGTCAGCTGCATGAAGCTGGAGGGCAG
ATCCTGAAAGGCATCTTGGAGGGTGCTTCCCACATCCTGCCTGCATTCCGGGTCCTGAGC
AGTCTTCTCTCCAGCTGCAGTGATTCTGTTGCCTTGTATTCCTTCTGCCGGGAGGCAGGG
CTTCCTGGGCTGCTGCTGAGTCTACTCAGGCACAGTCAGGAGAGCAACAGCCTCCAGCAG
CAATCTTGGTATGGGACCTTCTTACAGGACCTGATGGCTGTGATTCAGGCCTACTTTGCC
TGTACCTTCAATCTGGAGAGGAGCCAGACAAGTGACAGCCTGCAGGTGTTTCAGGAGGCT
GCCAACCTTTTTCTGGACCTGTTGGGGAAACTGCTGGCCCAACCAGATGACTCTGAGCAG
ACTTTGCGGAGGGACAGCCTTATGTGCTTTACTGTCCTGTGCGAAGCCATGGATGGGAAC
AGCCGGGCCATCTCCAAAGCCTTTTACTCCAGCTTGCTGACGACACAGCAGGTTGTCTTG
GATGGGCTCCTTCATGGCTTGACAGTTCCACAGCTCCCTGTCCACACTCCCCAAGGAGCC
CCGCAAGTGAGCCAGCCACTGCGAGAGCAGAGTGAGGATATACCTGGAGCCATTTCCTCT
GCCCTGGCAGCCATATGCACTGCTCCTGTGGGACTGCCCGACTGCTGGGATGCCAAGGAG
CAGGTCTGTTGGCATTTGGCAAATCAGCTAACTGAAGACAGCAGCCAGCTCAGGCCATCC
CTCATCTCTGGCCTGCAGCATCCCATCCTGTGCCTGCACCTTCTCAAGGTTCTATACTCC
TGCTGCCTTGTCAGTGAGGGCCTGTGCCGTCTTCTGGGGCAGGAGCCCCTGGCCTTGGAA
TCCCTGTTTATGTTGATTCAGGGCAAGGTAAAAGTAGTAGATTGGGAAGAGTCTACTGAA
GTGACACTCTACTTCCTCTCCCTTCTTGTCTTTCGGCTCCAAAACCTGCCTTGTGGAATG
GAGAAGCTAGGCAGTGACGTTGCTACTCTCTTTACCCATTCGCATGTCGTCTCTCTTGTG
AGTGCAGCAGCCTGTCTATTGGGACAGCTTGGTCAGCAAGGGGTGACCTTTGACCTCCAG
CCCATGGAATGGATGGCTGCAGCCACACATGCCTTGTCTGCCCCTGCAGAGGTTCGGTTG
ACTCCACCAGGTAGTTGTGGATTCTATGATGGCCTCCTTATCCTTCTGTTGCAGCTCCTC
ACTGAGCAGGGGAAGGCTAGCCTAATCAGGGATATGTCCAGTTCAGAAATGTGGACCGTT
TTGTGGCACCGCTTCTCCATGGTCCTGAGGCTCCCCGAGGAGGCATCTGCACAGGAAGGG
GAGCTTTCGCTATCCAGTCCACCAAGCCCTGAGCCAGACTGGACACTGATTTCTCCCCAG
GGCATGGCAGCCCTGCTGAGCCTGGCCATGGCCACCTTTACCCAGGAGCCCCAGTTATGC
CTGAGCTGCCTGTCCCAGCATGGAAGTATCCTCATGTCCATCCTGAAGCATCTGCTTTGC
CCCAGCTTCCTGAATCAACTGCGCCAGGCGCCTCATGGGTCTGAGTTTCTCCCTGTCGTG
GTGCTCTCTGTCTGCCAGCTCCTTTGCTTCCCCTTTGCGCTGGACATGGATGCTGACCTC
CTTATAGGTGTCTTGGCCGACCTCAGGGACTCAGAAGTTGCAGCCCATCTGCTGCAGGTC
TGCTGCTACCATCTTCCGTTGATGCAAGTGGAGCTGCCCATCAGCCTTCTCACACGCCTG
GCCCTCATGGATCCCACCTCTCTCAACCAGTTTGTGAACACAGTGTCTGCCTCCCCTAGA
ACCATCGTCTCGTTTCTCTCAGTTGCCCTCCTGAGTGACCAGCCACTGTTGACCTCCGAC
CTTCTCTCTCTGCTGGCCCATACTGCCAGGGTCCTGTCTCCCAGCCACTTGTCCTTTATC
CAAGAGCTTCTGGCTGGCTCTGATGAATCCTATCGGCCCCTGCGCAGCCTCCTGGGCCAC
CCAGAGAATTCTGTGCGGGCACACACTTATAGGCTCCTGGGACACTTGCTCCAACACAGC
ATGGCCCTGCGTGGGGCACTGCAGAGCCAGTCTGGACTGCTCAGCCTTCTGCTGCTTGGG
CTTGGAGACAAGGATCCTGTTGTGCGGTGCAGTGCCAGCTTTGCTGTGGGCAATGCAGCC
TACCAGGCTGGTCCTCTGGGACCTGCCCTGGCAGCTGCAGTGCCCAGTATGACCCAGCTG
CTTGGAGATCCTCAGGCTGGTATCCGGCGCAATGTTGCATCAGCTCTGGGCAACTTGGGA
CCTGAAGGTTTGGGAGAGGAGCTGTTACAGTGCGAAGTACCCCAGCGGCTCCTAGAAATG
GCATGTGGAGACCCCCAGCCAAATGTGAAGGAGGCTGCCCTCATTGCCCTCCGGAGCCTG
CAACAGGAGCCTGGCATCCATCAGGTACTGGTGTCCCTGGGTGCCAGTGAGAAACTATCC
TTGCTCTCTCTGGGGAATCAGTCACTGCCACACAGCAGTCCTAGGCCTGCCTCTGCCAAA
CACTGCAGGAAACTCATTCACCTCCTGAGGCCAGCCCATAGCATGTGA
Chromosome Location
2
Locus
2q35
External Identifiers
ResourceLink
UniProtKB IDQ9NRP7
UniProtKB Entry NameSTK36_HUMAN
HGNC IDHGNC:17209
General References
  1. Murone M, Luoh SM, Stone D, Li W, Gurney A, Armanini M, Grey C, Rosenthal A, de Sauvage FJ: Gli regulation by the opposing activities of fused and suppressor of fused. Nat Cell Biol. 2000 May;2(5):310-2. [Article]
  2. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [Article]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [Article]
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  7. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails