Malto-oligosyltrehalose trehalohydrolase

Details

Name
Malto-oligosyltrehalose trehalohydrolase
Synonyms
  • 3.2.1.141
  • 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase
  • Maltooligosyl trehalose trehalohydrolase
  • MTHase
Gene Name
treZ
Organism
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Amino acid sequence
>lcl|BSEQ0012073|Malto-oligosyltrehalose trehalohydrolase
MTQTQPVTPTPPASFQTQHDPRTRLGATPLPGGAGTRFRLWTSTARTVAVRVNGTEHVMT
SLGGGIYELELPVGPGARYLFVLDGVPTPDPYARFLPDGVHGEAEVVDFGTFDWTDADWH
GIKLADCVFYEVHVGTFTPEGTYRAAAEKLPYLKELGVTAIQVMPLAAFDGQRGWGYDGA
AFYAPYAPYGRPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDRFSSA
WGMGLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDATPYMTDDSETHILTELAQEIHELG
GTHLLLAEDHRNLPDLVTVNHLDGIWTDDFHHETRVTLTGEQEGYYAGYRGGAEALAYTI
RRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNHDQIGNRPLGERLHQSDGVTLH
EYRGAAALLLPMTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGRKKEFGGFSGFSGED
VPDPQAEQTFLNSKLNWAEREGGEHARTLRLYRDLLRLRREDPVLHNRQRENLTTGHDGD
VLWVRTVTGAGERVLLWNLGQDTRAVAEVKLPFTVPRRLLLHTEGREDLTLGAGEAVLVG
Number of residues
600
Molecular Weight
66909.235
Theoretical pI
5.26
GO Classification
Functions
4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase activity / cation binding
Processes
trehalose biosynthetic process
Components
cytoplasm
General Function
Cation binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0012074|Malto-oligosyltrehalose trehalohydrolase (treZ)
ATGACCCAGACCCAGCCTGTGACCCCGACCCCCCCCGCTTCTTTTCAGACCCAGCACGAC
CCGCGCACCCGTCTGGGCGCCACGCCCCTGCCCGGCGGCGCGGGCACCCGCTTTCGCCTG
TGGACCTCCACCGCCCGCACGGTGGCCGTGCGCGTGAACGGCACCGAGCACGTCATGACC
TCGCTCGGCGGCGGCATCTACGAACTGGAACTGCCGGTCGGCCCCGGCGCCCGCTACCTT
TTCGTGCTCGACGGCGTGCCAACCCCCGACCCCTACGCCCGCTTTTTGCCCGACGGCGTG
CACGGCGAAGCGGAAGTGGTGGACTTCGGCACCTTCGACTGGACAGACGCCGACTGGCAC
GGCATCAAACTCGCCGACTGCGTGTTCTACGAGGTGCATGTGGGCACCTTTACCCCGGAA
GGCACCTACCGCGCCGCCGCCGAGAAGCTGCCGTACCTGAAAGAGCTGGGCGTGACGGCC
ATTCAAGTGATGCCGCTCGCCGCCTTTGACGGGCAGCGCGGCTGGGGCTACGACGGCGCC
GCCTTTTACGCGCCCTACGCGCCGTATGGCCGCCCTGAGGACCTGATGGCCCTGGTAGAT
GCCGCGCACCGACTGGGGCTGGGCGTATTTCTGGACGTGGTGTACAACCACTTCGGGCCG
TCAGGCAATTACCTGAGCAGCTACGCGCCGAGCTATTTTACCGACCGCTTTTCGAGCGCC
TGGGGCATGGGGTTGGACTACGCCGAGCCGCACATGCGCCGCTACGTCACCGGCAACGCC
CGCATGTGGCTGCGCGATTACCACTTCGACGGGCTGCGGCTCGACGCCACGCCGTACATG
ACCGACGACAGCGAGACCCACATCCTGACCGAGCTGGCGCAGGAAATTCACGAACTCGGC
GGCACCCACCTGCTGCTCGCCGAGGATCACCGCAACCTGCCCGACCTGGTGACGGTCAAC
CACCTCGACGGCATCTGGACCGACGACTTTCACCACGAAACGCGCGTCACCCTGACCGGC
GAGCAGGAAGGCTACTACGCCGGCTACCGGGGCGGCGCCGAAGCCCTCGCCTACACCATC
CGCCGGGGCTGGCGCTACGAGGGGCAGTTCTGGGCGGTCAAGGGCGAGGAGCACGAGCGC
GGCCACCCCTCCGACGCGCTGGAGGCCCCCAACTTCGTCTACTGCATCCAGAACCACGAC
CAGATCGGCAACCGGCCCCTGGGCGAGCGGCTGCACCAGTCGGACGGAGTGACGCTGCAC
GAGTACCGGGGCGCCGCCGCGCTGCTGCTGCCGATGACCCCGCTGCTGTTTCAGGGCCAG
GAATGGGCTGCCAGCACGCCGTTTCAGTTTTTCAGCGACCACGCGGGCGAGTTGGGACAG
GCCGTATCCGAAGGCCGCAAAAAGGAATTCGGGGGCTTCAGCGGCTTCAGCGGCGAGGAC
GTGCCCGACCCGCAGGCCGAGCAGACTTTCCTCAACTCCAAACTGAACTGGGCCGAGCGC
GAGGGCGGCGAACACGCCCGCACCCTGCGCCTGTACCGCGACCTGCTGCGGCTGCGGCGC
GAGGACCCGGTGCTGCACAACCGCCAGCGCGAGAACCTGACCACCGGCCACGACGGCGAC
GTGCTGTGGGTCCGTACCGTGACCGGCGCAGGCGAGCGGGTGCTGCTGTGGAACCTGGGC
CAGGACACGCGGGCCGTCGCCGAGGTCAAGTTGCCCTTCACCGTGCCTAGGCGCCTGCTG
CTGCATACCGAAGGGCGCGAGGATTTGACGCTGGGGGCGGGGGAAGCGGTGTTGGTGGGG
TGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9RX51
UniProtKB Entry NameTREZ_DEIRA
GenBank Gene IDAE000513
General References
  1. White O, Eisen JA, Heidelberg JF, Hickey EK, Peterson JD, Dodson RJ, Haft DH, Gwinn ML, Nelson WC, Richardson DL, Moffat KS, Qin H, Jiang L, Pamphile W, Crosby M, Shen M, Vamathevan JJ, Lam P, McDonald L, Utterback T, Zalewski C, Makarova KS, Aravind L, Daly MJ, Minton KW, Fleischmann RD, Ketchum KA, Nelson KE, Salzberg S, Smith HO, Venter JC, Fraser CM: Genome sequence of the radioresistant bacterium Deinococcus radiodurans R1. Science. 1999 Nov 19;286(5444):1571-7. [PubMed:10567266]
  2. Timmins J, Leiros HK, Leonard G, Leiros I, McSweeney S: Crystal structure of maltooligosyltrehalose trehalohydrolase from Deinococcus radiodurans in complex with disaccharides. J Mol Biol. 2005 Apr 15;347(5):949-63. [PubMed:15784255]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB03323Maltoseexperimental, investigationalunknownDetails