Catridecacog

Identification

Summary

Catridecacog is a recombinant FXIII subunit‐A molecule evaluated for clotting factor replacement therapy in congenital FXIII deficiency.

Brand Names
Novothirteen, Tretten
Generic Name
Catridecacog
DrugBank Accession Number
DB09310
Background

Coagulation Factor XIII A-Subunit (Recombinant), also known as catridecacog, is a recombinant form of the Factor XIII-A2 homodimer composed of two factor XIII (FXIII) A-subunits Label. For people with congenital deficiency or mutation of Factor XIII, a rare bleeding disorder, exogenous replacement of this key coagulation factor is essential for management and prevention of bleeding episodes.

Also known as Fibrin Stabilizing Factor (FSF), Factor XIII is an endogenously available coagulation factor and the final enzyme within the blood coagulation cascade. Within the body, FXIII circulates as a heterotetramer composed of 2 catalytic A-subunits and 2 non-catalytic B-subunits (FXIII-A2B2) 4. When activated by thrombin at the site of injury, the FXIII A2B2 pro-enzyme is cleaved resulting in activation of the catalytic A-subunit and dissociation from its carrier B-subunit. As a result, the active transglutaminase from subunit A cross-links fibrin and other proteins resulting in increased mechanical strength and resistance to fibrinolysis of the fibrin clot. This contributes to enhanced platelet and clot adhesion to injured tissue, thereby improving blood coagulation and maintenance of hemostasis 2.

When supplied as the recombinant form, Coagulation Factor XIII A-Subunit (Recombinant) binds to free human FXIII B-subunit resulting in a heterotetramer (rA2B2) with a similar activity profile and half-life as the endogenously available form. In patients with congenital factor XIII A-subunit deficiency, this product (marketed as Tretten) is indicated for the routine prophylaxis of bleeding. In these patients, activated rFXIII has been shown to increase the mechanical strength of fibrin clots, slow down fibrinolysis, and to enhance platelet adhesion to the site of injury. As the half-life of endogenous Factor XIII is long (5-11 days), prophylactic therapy with the replacement of FXIII can be given every 4-6 to maintain hemostasis4.

Other drug products with similar structure and function to Coagulation Factor XIII A-Subunit (Recombinant) include Factor XIII (human), which is a purified endogenous (human) form of coagulation factor XIII. Compared to Coagulation Factor XIII A-Subunit (Recombinant), which is produced through recombinant DNA technology where the target protein is grown in yeast and then isolated, the human form is isolated from pooled human plasma.

Coagulation Factor XIII A-Subunit (Recombinant) is available in the US as the commmercially available product Tretten, and in the EU as NovoThirteen. Tretten is manufactured as an intracellular, soluble protein in yeast (Saccharomyces cerevisiae) production strain containing the episomal expression vector, pD16. It is subsequently isolated by homogenization of cells and purification by several chromatography steps, including hydrophobic interaction and ion exchange chromatography Label.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Blood factors
Protein Structure
Db09310
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>Coagulation Factor XIII A-Subunit (dimer)
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF
RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKET
LRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYG
ELDVQIQRRPSM
Download FASTA Format
Synonyms
  • Blood Coagulation Factor XIII (Synthetic Human A-Chain Precursor)
  • Catridecacog
  • Coagulation Factor XIII A-Subunit (recombinant)
  • Factor XIII A-Subunit (Recombinant)
  • Human Factor XIII (A2) homodimer (allele F13A*1B), recombinant DNA origin
  • Recombinant Coagulation Factor XIII

Pharmacology

Indication

For routine prophylaxis of bleeding in patients with congenital factor XIII A-Subunit deficiency.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Not Available

Mechanism of action
TargetActionsOrganism
ACoagulation factor XIII B chainNot AvailableHumans
Absorption

Following intravenous administration, the maximum concentration (Cmax) was found to be 0.48 IU/mL Label.

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

7.1 days

Clearance

0.41 mL/h/kg

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

The most common adverse reactions reported in clinical trials (≥1%), were headache, pain in the extremities, injection site pain, and increase in fibrin D dimer levels. Due to the anti-clotting activity of this medication, thromboembolic complications may occur with its usage.

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Abciximab.
AcenocoumarolThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Acenocoumarol.
Alpha-1-proteinase inhibitorAlpha-1-proteinase inhibitor may increase the thrombogenic activities of Catridecacog.
AlteplaseThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Alteplase.
Aminocaproic acidThe risk or severity of adverse effects can be increased when Aminocaproic acid is combined with Catridecacog.
AncrodThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Ancrod.
AnistreplaseThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Anistreplase.
Antithrombin AlfaThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Antithrombin Alfa.
Antithrombin III humanThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Antithrombin III human.
ApixabanThe therapeutic efficacy of Catridecacog can be decreased when used in combination with Apixaban.
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
No interactions found.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
NovothirteenInjection, powder, for solution2500 IUIntravenousNovo Nordisk2016-09-08Not applicableEU flag
TrettenKit2500 [iU]/3mLIntravenousNovo Nordisk2013-12-23Not applicableUS flag
TrettenPowder, for solution2500 unit / vialIntravenousNovo Nordisk2013-01-30Not applicableCanada flag

Categories

ATC Codes
B02BD11 — Catridecacog
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
NU23Q531G1
CAS number
606138-08-3

References

General References
  1. Korte W: Catridecacog: a breakthrough in the treatment of congenital factor XIII A-subunit deficiency? J Blood Med. 2014 Jul 9;5:107-13. doi: 10.2147/JBM.S35395. eCollection 2014. [Article]
  2. Schroeder V, Kohler HP: Factor XIII: Structure and Function. Semin Thromb Hemost. 2016 Jun;42(4):422-8. doi: 10.1055/s-0036-1571341. Epub 2016 Mar 28. [Article]
  3. Inbal A, Oldenburg J, Carcao M, Rosholm A, Tehranchi R, Nugent D: Recombinant factor XIII: a safe and novel treatment for congenital factor XIII deficiency. Blood. 2012 May 31;119(22):5111-7. doi: 10.1182/blood-2011-10-386045. Epub 2012 Mar 26. [Article]
  4. Hsieh L, Nugent D: Factor XIII deficiency. Haemophilia. 2008 Nov;14(6):1190-200. doi: 10.1111/j.1365-2516.2008.01857.x. [Article]
KEGG Drug
D10532
PubChem Substance
347910434
RxNav
1488293
ChEMBL
CHEMBL2108282
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Catridecacog
FDA label
Download (220 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3CompletedPreventionCongenital FXIII Deficiency / Congenital Hematological Disorder2
3CompletedTreatmentCongenital FXIII Deficiency / Congenital Hematological Disorder2
2CompletedPreventionAcquired Bleeding Disorder / Cardiac Surgery Requiring Cardiopulmonary Bypass1
2TerminatedTreatmentInflammation / Ulcerative Colitis1
1CompletedTreatmentAcquired Bleeding Disorder / Cardiac Surgery Requiring Cardiopulmonary Bypass1
1CompletedTreatmentAcquired Bleeding Disorder / Cardiac Surgery Requiring Cardiopulmonary Bypass / Healthy Subjects (HS)1
1CompletedTreatmentCongenital FXIII Deficiency / Congenital Hematological Disorder1
1CompletedTreatmentCongenital FXIII Deficiency / Congenital Hematological Disorder / Healthy Subjects (HS)3
Not AvailableCompletedNot AvailableCongenital FXIII Deficiency / Congenital Hematological Disorder1
Not AvailableEnrolling by InvitationNot AvailableCongenital FXIII Deficiency / Congenital Hematological Disorder1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
Injection, powder, for solutionIntravenous2500 IU
KitIntravenous2500 [iU]/3mL
Powder, for solutionIntravenous2500 unit / vial
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin.
Specific Function
Not Available
Gene Name
F13B
Uniprot ID
P05160
Uniprot Name
Coagulation factor XIII B chain
Molecular Weight
75510.1 Da

Drug created on November 13, 2015 19:08 / Updated on September 25, 2021 16:29