DNA polymerase III subunit beta
Details
- Name
- DNA polymerase III subunit beta
- Synonyms
- 2.7.7.7
- Beta clamp
- Beta sliding clamp
- Gene Name
- dnaN
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0017219|DNA polymerase III subunit beta MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVC SMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGR FPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQE EAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYV VMPMRL
- Number of residues
- 366
- Molecular Weight
- 40586.255
- Theoretical pI
- 5.05
- GO Classification
- Functions3'-5' exonuclease activity / DNA binding / DNA-directed DNA polymerase activity / identical protein bindingProcessescellular response to DNA damage stimulus / DNA strand elongation involved in DNA replicationComponentscytosol / DNA polymerase III complex
- General Function
- Identical protein binding
- Specific Function
- DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity. The beta chain is required for initiation of replication; once it is clamped onto DNA it slides freely (bidirectional and ATP-independent) along duplex DNA. Coordinates protein traffic at the replication fork, where it interacts with multiple DNA polymerases.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0017220|DNA polymerase III subunit beta (dnaN) ATGAAATTTACCGTAGAACGTGAGCATTTATTAAAACCGCTACAACAGGTGAGCGGTCCG TTAGGTGGTCGTCCTACGCTACCGATTCTCGGTAATCTGCTGTTACAGGTTGCTGACGGT ACGTTGTCGCTGACCGGTACTGATCTCGAGATGGAAATGGTGGCACGTGTTGCGCTGGTT CAGCCACACGAGCCAGGAGCGACGACCGTTCCGGCGCGCAAATTCTTTGATATCTGCCGT GGTCTGCCTGAAGGCGCGGAAATTGCCGTGCAGCTGGAAGGTGAACGGATGCTGGTACGC TCCGGGCGTAGCCGTTTTTCGCTGTCTACCCTGCCAGCGGCGGATTTCCCGAACCTCGAT GACTGGCAGAGTGAAGTCGAATTTACCCTGCCGCAGGCAACGATGAAGCGTCTGATTGAA GCGACCCAGTTTTCTATGGCGCATCAGGACGTTCGCTATTACTTAAATGGTATGCTGTTT GAAACCGAAGGTGAAGAACTGCGCACCGTGGCAACCGACGGCCACCGTCTGGCGGTCTGT TCAATGCCAATTGGTCAATCTTTGCCAAGCCATTCGGTGATCGTACCGCGTAAAGGCGTG ATTGAACTGATGCGTATGCTCGACGGCGGCGACAATCCGCTGCGCGTACAGATTGGCAGC AACAACATTCGCGCCCACGTTGGCGACTTTATCTTCACCTCCAAACTGGTGGATGGTCGC TTCCCGGATTATCGCCGCGTTCTGCCGAAGAACCCGGACAAACATCTGGAAGCTGGCTGC GATCTGCTCAAGCAGGCGTTTGCTCGCGCGGCGATTCTCTCTAACGAGAAATTCCGCGGC GTACGTCTTTATGTCAGCGAAAACCAGCTGAAAATCACCGCCAACAACCCGGAACAGGAA GAAGCGGAAGAGATCCTCGACGTTACCTATAGCGGTGCGGAGATGGAAATCGGCTTCAAC GTCAGTTATGTGCTGGATGTTCTGAACGCGCTGAAATGCGAAAACGTCCGCATGATGCTG ACCGATTCGGTTTCCAGCGTGCAGATTGAAGATGCGGCCAGCCAGAGCGCGGCTTATGTT GTCATGCCAATGAGACTGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A988 UniProtKB Entry Name DPO3B_ECOLI GenBank Protein ID 145759 GenBank Gene ID J01602 - General References
- Ohmori H, Kimura M, Nagata T, Sakakibara Y: Structural analysis of the dnaA and dnaN genes of Escherichia coli. Gene. 1984 May;28(2):159-70. [Article]
- Burland V, Plunkett G 3rd, Daniels DL, Blattner FR: DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. Genomics. 1993 Jun;16(3):551-61. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Armengod ME, Garcia-Sogo M, Lambies E: Transcriptional organization of the dnaN and recF genes of Escherichia coli K-12. J Biol Chem. 1988 Aug 25;263(24):12109-14. [Article]
- Armengod ME, Lambies E: Overlapping arrangement of the recF and dnaN operons of Escherichia coli; positive and negative control sequences. Gene. 1986;43(3):183-96. [Article]
- Blanar MA, Sandler SJ, Armengod ME, Ream LW, Clark AJ: Molecular analysis of the recF gene of Escherichia coli. Proc Natl Acad Sci U S A. 1984 Aug;81(15):4622-6. [Article]
- Adachi T, Mizuuchi K, Menzel R, Gellert M: DNA sequence and transcription of the region upstream of the E. coli gyrB gene. Nucleic Acids Res. 1984 Aug 24;12(16):6389-95. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Kurz M, Dalrymple B, Wijffels G, Kongsuwan K: Interaction of the sliding clamp beta-subunit and Hda, a DnaA-related protein. J Bacteriol. 2004 Jun;186(11):3508-15. [Article]
- Sutton MD: The Escherichia coli dnaN159 mutant displays altered DNA polymerase usage and chronic SOS induction. J Bacteriol. 2004 Oct;186(20):6738-48. [Article]
- Su'etsugu M, Nakamura K, Keyamura K, Kudo Y, Katayama T: Hda monomerization by ADP binding promotes replicase clamp-mediated DnaA-ATP hydrolysis. J Biol Chem. 2008 Dec 26;283(52):36118-31. doi: 10.1074/jbc.M803158200. Epub 2008 Oct 30. [Article]
- Davies BW, Kohanski MA, Simmons LA, Winkler JA, Collins JJ, Walker GC: Hydroxyurea induces hydroxyl radical-mediated cell death in Escherichia coli. Mol Cell. 2009 Dec 11;36(5):845-60. doi: 10.1016/j.molcel.2009.11.024. [Article]
- Baxter JC, Sutton MD: Evidence for roles of the Escherichia coli Hda protein beyond regulatory inactivation of DnaA. Mol Microbiol. 2012 Aug;85(4):648-68. doi: 10.1111/j.1365-2958.2012.08129.x. Epub 2012 Jul 13. [Article]
- Ozaki S, Matsuda Y, Keyamura K, Kawakami H, Noguchi Y, Kasho K, Nagata K, Masuda T, Sakiyama Y, Katayama T: A replicase clamp-binding dynamin-like protein promotes colocalization of nascent DNA strands and equipartitioning of chromosomes in E. coli. Cell Rep. 2013 Sep 12;4(5):985-95. doi: 10.1016/j.celrep.2013.07.040. Epub 2013 Aug 30. [Article]
- Kong XP, Onrust R, O'Donnell M, Kuriyan J: Three-dimensional structure of the beta subunit of E. coli DNA polymerase III holoenzyme: a sliding DNA clamp. Cell. 1992 May 1;69(3):425-37. [Article]
- Oakley AJ, Prosselkov P, Wijffels G, Beck JL, Wilce MC, Dixon NE: Flexibility revealed by the 1.85 A crystal structure of the beta sliding-clamp subunit of Escherichia coli DNA polymerase III. Acta Crystallogr D Biol Crystallogr. 2003 Jul;59(Pt 7):1192-9. Epub 2003 Jun 27. [Article]
- Bunting KA, Roe SM, Pearl LH: Structural basis for recruitment of translesion DNA polymerase Pol IV/DinB to the beta-clamp. EMBO J. 2003 Nov 3;22(21):5883-92. [Article]
- O'Donnell M: Accessory protein function in the DNA polymerase III holoenzyme from E. coli. Bioessays. 1992 Feb;14(2):105-11. [Article]