Protein S100-A7
Details
- Name
- Protein S100-A7
- Synonyms
- PSOR1
- Psoriasin
- S100 calcium-binding protein A7
- S100A7C
- Gene Name
- S100A7
- UniProtKB Entry
- P31151Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0012623|Protein S100-A7 MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
- Number of residues
- 101
- Molecular Weight
- 11470.87
- Theoretical pI
- 6.78
- GO Classification
- Functionscalcium ion binding / RAGE receptor binding / zinc ion bindingProcessesangiogenesis / epidermis development / keratinocyte differentiation / positive regulation of ERK1 and ERK2 cascade / positive regulation of granulocyte chemotaxis / positive regulation of monocyte chemotaxis / positive regulation of T cell chemotaxis / response to lipopolysaccharide / response to reactive oxygen speciesComponentscytoplasm / cytosol / endoplasmic reticulum / extracellular region / focal adhesion / nucleus
- General Function
- Not Available
- Specific Function
- Calcium ion binding
- Pfam Domain Function
- S_100 (PF01023)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0012624|Protein S100-A7 (S100A7) ATGAGCAACACTCAAGCTGAGAGGTCCATAATAGGCATGATCGACATGTTTCACAAATAC ACCAGACGTGATGACAAGATTGAGAAGCCAAGCCTGCTGACGATGATGAAGGAGAACTTC CCCAACTTCCTTAGTGCCTGTGACAAAAAGGGCACAAATTACCTCGCCGATGTCTTTGAG AAAAAGGACAAGAATGAGGATAAGAAGATTGATTTTTCTGAGTTTCTGTCCTTGCTGGGA GACATAGCCACAGACTACCACAAGCAGAGCCATGGAGCAGCGCCCTGTTCCGGGGGCAGC CAGTGA
- Chromosome Location
- 1
- Locus
- 1q21.3
- External Identifiers
Resource Link UniProtKB ID P31151 UniProtKB Entry Name S10A7_HUMAN GenBank Protein ID 190668 GenBank Gene ID M86757 GeneCard ID S100A7 HGNC ID HGNC:10497 PDB ID(s) 1PSR, 2PSR, 2WND, 2WOR, 2WOS, 3PSR, 4AQJ KEGG ID hsa:6278 NCBI Gene ID 6278 - General References
- Madsen P, Rasmussen HH, Leffers H, Honore B, Dejgaard K, Olsen E, Kiil J, Walbum E, Andersen AH, Basse B, et al.: Molecular cloning, occurrence, and expression of a novel partially secreted protein "psoriasin" that is highly up-regulated in psoriatic skin. J Invest Dermatol. 1991 Oct;97(4):701-12. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Burgisser DM, Siegenthaler G, Kuster T, Hellman U, Hunziker P, Birchler N, Heizmann CW: Amino acid sequence analysis of human S100A7 (psoriasin) by tandem mass spectrometry. Biochem Biophys Res Commun. 1995 Dec 5;217(1):257-63. [Article]
- Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE, Vandekerckhove J: Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes. Electrophoresis. 1992 Dec;13(12):960-9. [Article]
- Celis JE, Rasmussen HH, Vorum H, Madsen P, Honore B, Wolf H, Orntoft TF: Bladder squamous cell carcinomas express psoriasin and externalize it to the urine. J Urol. 1996 Jun;155(6):2105-12. [Article]
- Emberley ED, Gietz RD, Campbell JD, HayGlass KT, Murphy LC, Watson PH: RanBPM interacts with psoriasin in vitro and their expression correlates with specific clinical features in vivo in breast cancer. BMC Cancer. 2002 Nov 6;2:28. [Article]
- Kulski JK, Lim CP, Dunn DS, Bellgard M: Genomic and phylogenetic analysis of the S100A7 (Psoriasin) gene duplications within the region of the S100 gene cluster on human chromosome 1q21. J Mol Evol. 2003 Apr;56(4):397-406. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Brodersen DE, Etzerodt M, Madsen P, Celis JE, Thogersen HC, Nyborg J, Kjeldgaard M: EF-hands at atomic resolution: the structure of human psoriasin (S100A7) solved by MAD phasing. Structure. 1998 Apr 15;6(4):477-89. [Article]
- Brodersen DE, Nyborg J, Kjeldgaard M: Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states. Biochemistry. 1999 Feb 9;38(6):1695-704. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Protein S100-A7 (Humans) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 8-anilinonaphthalene-1-sulfonic acid experimental unknown target Details Zinc approved, investigational unknown target Details Zinc acetate approved, investigational unknown target Details Zinc chloride approved, investigational unknown target binder Details Ibuprofen approved unknown target inducer Details Dexibuprofen approved, investigational unknown target Details Zinc sulfate, unspecified form approved, experimental unknown target binder Details