Alpha,alpha-trehalose-phosphate synthase [UDP-forming]

Details

Name
Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
Synonyms
  • 2.4.1.15
  • Osmoregulatory trehalose synthesis protein A
  • Trehalose-6-phosphate synthase
  • UDP-glucose-glucosephosphate glucosyltransferase
Gene Name
otsA
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0016390|Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNEDQPLKKVKKGN
ITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLLPL
LQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDY
DLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAAGP
LPPKLAQLKAELKNVQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTS
RGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRKLLMKIFRYSDVGLVTPL
RDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAALDRALTMS
LAERISRHAEMLDVIVKNDINHWQECFISDLKQIVPRSAESQQRDKVATFPKLA
Number of residues
474
Molecular Weight
53610.655
Theoretical pI
6.85
GO Classification
Functions
alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity
Processes
cellular response to DNA damage stimulus / response to osmotic stress / trehalose biosynthetic process / trehalose metabolism in response to cold stress
Components
cytosol
General Function
Alpha,alpha-trehalose-phosphate synthase (udp-forming) activity
Specific Function
Catalyzes the transfer of glucose from UDP-glucose to glucose-6-phosphate to form alpha,alpha-1,1 trehalose-6-phosphate. Acts with retention of the anomeric configuration of the UDP-sugar donor. Essential for viability of the cells at low temperatures and at elevated osmotic strength.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016391|Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (otsA)
ATGAGTCGTTTAGTCGTAGTATCTAACCGGATTGCACCACCAGACGAGCACGCCGCCAGT
GCCGGTGGCCTTGCCGTTGGCATACTGGGGGCACTGAAAGCCGCAGGCGGACTGTGGTTT
GGCTGGAGTGGTGAAACAGGGAATGAGGATCAGCCGCTAAAAAAGGTGAAAAAAGGTAAC
ATTACGTGGGCCTCTTTTAACCTCAGCGAACAGGACCTTGACGAATACTACAACCAATTC
TCCAATGCCGTTCTCTGGCCCGCTTTTCATTATCGGCTCGATCTGGTGCAATTTCAGCGT
CCTGCCTGGGACGGCTATCTACGCGTAAATGCGTTGCTGGCAGATAAATTACTGCCGCTG
TTGCAAGACGATGACATTATCTGGATCCACGATTATCACCTGTTGCCATTTGCGCATGAA
TTACGCAAACGGGGAGTGAATAATCGCATTGGTTTCTTTCTGCATATTCCTTTCCCGACA
CCGGAAATCTTCAACGCGCTGCCGACATATGACACCTTGCTTGAACAGCTTTGTGATTAT
GATTTGCTGGGTTTCCAGACAGAAAACGATCGTCTGGCGTTCCTGGATTGTCTTTCTAAC
CTGACCCGCGTCACGACACGTAGCGCAAAAAGCCATACAGCCTGGGGCAAAGCATTTCGA
ACAGAAGTCTACCCGATCGGCATTGAACCGAAAGAAATAGCCAAACAGGCTGCCGGGCCA
CTGCCGCCAAAACTGGCGCAACTTAAAGCGGAACTGAAAAACGTACAAAATATCTTTTCT
GTCGAACGGCTGGATTATTCCAAAGGTTTGCCAGAGCGTTTTCTCGCCTATGAAGCGTTG
CTGGAAAAATATCCGCAGCATCATGGTAAAATTCGTTATACCCAGATTGCACCAACGTCG
CGTGGTGATGTGCAAGCCTATCAGGATATTCGTCATCAGCTCGAAAATGAAGCTGGACGA
ATTAATGGTAAATACGGGCAATTAGGCTGGACGCCGCTTTATTATTTGAATCAGCATTTT
GACCGTAAATTACTGATGAAAATATTCCGCTACTCTGACGTGGGCTTAGTGACGCCACTG
CGTGACGGGATGAACCTGGTAGCAAAAGAGTATGTTGCTGCTCAGGACCCAGCCAATCCG
GGCGTTCTTGTTCTTTCGCAATTTGCGGGAGCGGCAAACGAGTTAACGTCGGCGTTAATT
GTTAACCCCTACGATCGTGACGAAGTTGCAGCTGCGCTGGATCGTGCATTGACTATGTCG
CTGGCGGAACGTATTTCCCGTCATGCAGAAATGCTGGACGTTATCGTGAAAAACGATATT
AACCACTGGCAGGAGTGCTTCATTAGCGACCTAAAGCAGATAGTTCCGCGAAGCGCGGAA
AGCCAGCAGCGCGATAAAGTTGCTACCTTTCCAAAGCTTGCGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP31677
UniProtKB Entry NameOTSA_ECOLI
GenBank Protein ID577561
GenBank Gene IDX69160
General References
  1. Kaasen I, McDougall J, Strom AR: Analysis of the otsBA operon for osmoregulatory trehalose synthesis in Escherichia coli and homology of the OtsA and OtsB proteins to the yeast trehalose-6-phosphate synthase/phosphatase complex. Gene. 1994 Jul 22;145(1):9-15. [PubMed:8045430]
  2. Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.: A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):379-92. [PubMed:9097040]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [PubMed:9278503]
  4. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [PubMed:16738553]
  5. Kaasen I, Falkenberg P, Styrvold OB, Strom AR: Molecular cloning and physical mapping of the otsBA genes, which encode the osmoregulatory trehalose pathway of Escherichia coli: evidence that transcription is activated by katF (AppR) J Bacteriol. 1992 Feb;174(3):889-98. [PubMed:1310094]
  6. Giaever HM, Styrvold OB, Kaasen I, Strom AR: Biochemical and genetic characterization of osmoregulatory trehalose synthesis in Escherichia coli. J Bacteriol. 1988 Jun;170(6):2841-9. [PubMed:3131312]
  7. Hengge-Aronis R, Klein W, Lange R, Rimmele M, Boos W: Trehalose synthesis genes are controlled by the putative sigma factor encoded by rpoS and are involved in stationary-phase thermotolerance in Escherichia coli. J Bacteriol. 1991 Dec;173(24):7918-24. [PubMed:1744047]
  8. Kandror O, DeLeon A, Goldberg AL: Trehalose synthesis is induced upon exposure of Escherichia coli to cold and is essential for viability at low temperatures. Proc Natl Acad Sci U S A. 2002 Jul 23;99(15):9727-32. Epub 2002 Jul 8. [PubMed:12105274]
  9. Gibson RP, Turkenburg JP, Charnock SJ, Lloyd R, Davies GJ: Insights into trehalose synthesis provided by the structure of the retaining glucosyltransferase OtsA. Chem Biol. 2002 Dec;9(12):1337-46. [PubMed:12498887]
  10. Gibson RP, Tarling CA, Roberts S, Withers SG, Davies GJ: The donor subsite of trehalose-6-phosphate synthase: binary complexes with UDP-glucose and UDP-2-deoxy-2-fluoro-glucose at 2 A resolution. J Biol Chem. 2004 Jan 16;279(3):1950-5. Epub 2003 Oct 21. [PubMed:14570926]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02007alpha-D-glucose 6-phosphateexperimentalunknownDetails
DB03366Imidazoleexperimental, investigationalunknownDetails
DB03435Uridine-5'-DiphosphateexperimentalunknownDetails
DB03488Uridine-5'-diphosphate-2-deoxy-2-fluoro-alpha-D-galactoseexperimentalunknownDetails
DB01861Uridine diphosphate glucoseexperimentalunknownDetails