Cyclin-dependent kinase inhibitor 1

Details

Name
Cyclin-dependent kinase inhibitor 1
Synonyms
  • CAP20
  • CDK-interacting protein 1
  • CDKN1
  • CIP1
  • MDA-6
  • MDA6
  • Melanoma differentiation-associated protein 6
  • p21
  • PIC1
  • SDI1
  • WAF1
Gene Name
CDKN1A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049737|Cyclin-dependent kinase inhibitor 1
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Number of residues
164
Molecular Weight
18119.145
Theoretical pI
Not Available
GO Classification
Functions
cyclin binding / cyclin-dependent protein kinase activating kinase activity / cyclin-dependent protein serine/threonine kinase inhibitor activity / metal ion binding / protein complex binding / protein kinase binding / protein kinase inhibitor activity / ubiquitin protein ligase binding
Processes
animal organ regeneration / cell cycle arrest / cellular response to amino acid starvation / cellular response to DNA damage stimulus / cellular response to extracellular stimulus / cellular response to gamma radiation / cellular response to heat / cellular response to ionizing radiation / cellular response to UV-B / cellular senescence / DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest / DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator / G1/S transition of mitotic cell cycle / G2/M transition of mitotic cell cycle / intestinal epithelial cell maturation / intrinsic apoptotic signaling pathway / intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator / mitotic cell cycle arrest / negative regulation of apoptotic process / negative regulation of cell growth / negative regulation of cell proliferation / negative regulation of cyclin-dependent protein kinase activity / negative regulation of cyclin-dependent protein serine/threonine kinase activity / negative regulation of G1/S transition of mitotic cell cycle / negative regulation of gene expression / negative regulation of phosphorylation / positive regulation of B cell proliferation / positive regulation of fibroblast proliferation / positive regulation of programmed cell death / positive regulation of protein kinase activity / positive regulation of reactive oxygen species metabolic process / protein stabilization / Ras protein signal transduction / regulation of cyclin-dependent protein serine/threonine kinase activity / regulation of DNA biosynthetic process / regulation of protein import into nucleus, translocation / regulation of transcription from RNA polymerase II promoter / replicative senescence / response to arsenic-containing substance / response to corticosterone / response to drug / response to hyperoxia / response to organonitrogen compound / response to toxic substance / response to X-ray / stress-induced premature senescence
Components
cyclin-dependent protein kinase holoenzyme complex / cytosol / nuclear body / nucleolus / nucleoplasm / nucleus / PCNA-p21 complex / perinuclear region of cytoplasm / protein complex
General Function
May be involved in p53/TP53 mediated inhibition of cellular proliferation in response to DNA damage. Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex. Inhibits DNA synthesis by DNA polymerase delta by competing with POLD3 for PCNA binding (PubMed:11595739).
Specific Function
Cyclin binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0049738|Cyclin-dependent kinase inhibitor 1 (CDKN1A)
ATGTCAGAACCGGCTGGGGATGTCCGTCAGAACCCATGCGGCAGCAAGGCCTGCCGCCGC
CTCTTCGGCCCAGTGGACAGCGAGCAGCTGAGCCGCGACTGTGATGCGCTAATGGCGGGC
TGCATCCAGGAGGCCCGTGAGCGATGGAACTTCGACTTTGTCACCGAGACACCACTGGAG
GGTGACTTCGCCTGGGAGCGTGTGCGGGGCCTTGGCCTGCCCAAGCTCTACCTTCCCACG
GGGCCCCGGCGAGGCCGGGATGAGTTGGGAGGAGGCAGGCGGCCTGGCACCTCACCTGCT
CTGCTGCAGGGGACAGCAGAGGAAGACCATGTGGACCTGTCACTGTCTTGTACCCTTGTG
CCTCGCTCAGGGGAGCAGGCTGAAGGGTCCCCAGGTGGACCTGGAGACTCTCAGGGTCGA
AAACGGCGGCAGACCAGCATGACAGATTTCTACCACTCCAAACGCCGGCTGATCTTCTCC
AAGAGGAAGCCCTAA
Chromosome Location
6
Locus
6p21.2
External Identifiers
ResourceLink
UniProtKB IDP38936
UniProtKB Entry NameCDN1A_HUMAN
HGNC IDHGNC:1784
General References
  1. Harper JW, Adami GR, Wei N, Keyomarsi K, Elledge SJ: The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases. Cell. 1993 Nov 19;75(4):805-16. [Article]
  2. el-Deiry WS, Tokino T, Velculescu VE, Levy DB, Parsons R, Trent JM, Lin D, Mercer WE, Kinzler KW, Vogelstein B: WAF1, a potential mediator of p53 tumor suppression. Cell. 1993 Nov 19;75(4):817-25. [Article]
  3. Xiong Y, Hannon GJ, Zhang H, Casso D, Kobayashi R, Beach D: p21 is a universal inhibitor of cyclin kinases. Nature. 1993 Dec 16;366(6456):701-4. [Article]
  4. Jiang H, Lin J, Su ZZ, Herlyn M, Kerbel RS, Weissman BE, Welch DR, Fisher PB: The melanoma differentiation-associated gene mda-6, which encodes the cyclin-dependent kinase inhibitor p21, is differentially expressed during growth, differentiation and progression in human melanoma cells. Oncogene. 1995 May 4;10(9):1855-64. [Article]
  5. Noda A, Ning Y, Venable SF, Pereira-Smith OM, Smith JR: Cloning of senescent cell-derived inhibitors of DNA synthesis using an expression screen. Exp Cell Res. 1994 Mar;211(1):90-8. [Article]
  6. Mousses S, Ozcelik H, Lee PD, Malkin D, Bull SB, Andrulis IL: Two variants of the CIP1/WAF1 gene occur together and are associated with human cancer. Hum Mol Genet. 1995 Jun;4(6):1089-92. [Article]
  7. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [Article]
  8. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [Article]
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  10. Chen X, Chi Y, Bloecher A, Aebersold R, Clurman BE, Roberts JM: N-acetylation and ubiquitin-independent proteasomal degradation of p21(Cip1). Mol Cell. 2004 Dec 3;16(5):839-47. [Article]
  11. Scott MT, Morrice N, Ball KL: Reversible phosphorylation at the C-terminal regulatory domain of p21(Waf1/Cip1) modulates proliferating cell nuclear antigen binding. J Biol Chem. 2000 Apr 14;275(15):11529-37. [Article]
  12. LaBaer J, Garrett MD, Stevenson LF, Slingerland JM, Sandhu C, Chou HS, Fattaey A, Harlow E: New functional activities for the p21 family of CDK inhibitors. Genes Dev. 1997 Apr 1;11(7):847-62. [Article]
  13. Touitou R, Richardson J, Bose S, Nakanishi M, Rivett J, Allday MJ: A degradation signal located in the C-terminus of p21WAF1/CIP1 is a binding site for the C8 alpha-subunit of the 20S proteasome. EMBO J. 2001 May 15;20(10):2367-75. [Article]
  14. Ducoux M, Urbach S, Baldacci G, Hubscher U, Koundrioukoff S, Christensen J, Hughes P: Mediation of proliferating cell nuclear antigen (PCNA)-dependent DNA replication through a conserved p21(Cip1)-like PCNA-binding motif present in the third subunit of human DNA polymerase delta. J Biol Chem. 2001 Dec 28;276(52):49258-66. Epub 2001 Oct 10. [Article]
  15. Rossig L, Jadidi AS, Urbich C, Badorff C, Zeiher AM, Dimmeler S: Akt-dependent phosphorylation of p21(Cip1) regulates PCNA binding and proliferation of endothelial cells. Mol Cell Biol. 2001 Aug;21(16):5644-57. [Article]
  16. Wang Z, Bhattacharya N, Mixter PF, Wei W, Sedivy J, Magnuson NS: Phosphorylation of the cell cycle inhibitor p21Cip1/WAF1 by Pim-1 kinase. Biochim Biophys Acta. 2002 Dec 16;1593(1):45-55. [Article]
  17. Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S: N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome. Mol Cell Biol. 2004 Jul;24(14):6140-50. [Article]
  18. Heron-Milhavet L, Franckhauser C, Rana V, Berthenet C, Fisher D, Hemmings BA, Fernandez A, Lamb NJ: Only Akt1 is required for proliferation, while Akt2 promotes cell cycle exit through p21 binding. Mol Cell Biol. 2006 Nov;26(22):8267-80. Epub 2006 Sep 18. [Article]
  19. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [Article]
  20. Abbas T, Sivaprasad U, Terai K, Amador V, Pagano M, Dutta A: PCNA-dependent regulation of p21 ubiquitylation and degradation via the CRL4Cdt2 ubiquitin ligase complex. Genes Dev. 2008 Sep 15;22(18):2496-506. doi: 10.1101/gad.1676108. [Article]
  21. Kim Y, Starostina NG, Kipreos ET: The CRL4Cdt2 ubiquitin ligase targets the degradation of p21Cip1 to control replication licensing. Genes Dev. 2008 Sep 15;22(18):2507-19. doi: 10.1101/gad.1703708. [Article]
  22. Nishitani H, Shiomi Y, Iida H, Michishita M, Takami T, Tsurimoto T: CDK inhibitor p21 is degraded by a proliferating cell nuclear antigen-coupled Cul4-DDB1Cdt2 pathway during S phase and after UV irradiation. J Biol Chem. 2008 Oct 24;283(43):29045-52. doi: 10.1074/jbc.M806045200. Epub 2008 Aug 14. [Article]
  23. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
  24. Satyanarayana A, Kaldis P: A dual role of Cdk2 in DNA damage response. Cell Div. 2009 May 18;4:9. doi: 10.1186/1747-1028-4-9. [Article]
  25. Lee EW, Lee MS, Camus S, Ghim J, Yang MR, Oh W, Ha NC, Lane DP, Song J: Differential regulation of p53 and p21 by MKRN1 E3 ligase controls cell cycle arrest and apoptosis. EMBO J. 2009 Jul 22;28(14):2100-13. doi: 10.1038/emboj.2009.164. Epub 2009 Jun 18. [Article]
  26. Stuart SA, Wang JY: Ionizing radiation induces ATM-independent degradation of p21Cip1 in transformed cells. J Biol Chem. 2009 May 29;284(22):15061-70. doi: 10.1074/jbc.M808810200. Epub 2009 Mar 30. [Article]
  27. Wang Z, Zhang Y, Gu JJ, Davitt C, Reeves R, Magnuson NS: Pim-2 phosphorylation of p21(Cip1/WAF1) enhances its stability and inhibits cell proliferation in HCT116 cells. Int J Biochem Cell Biol. 2010 Jun;42(6):1030-8. doi: 10.1016/j.biocel.2010.03.012. Epub 2010 Mar 20. [Article]
  28. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [Article]
  29. Han J, Kim YL, Lee KW, Her NG, Ha TK, Yoon S, Jeong SI, Lee JH, Kang MJ, Lee MG, Ryu BK, Baik JH, Chi SG: ZNF313 is a novel cell cycle activator with an E3 ligase activity inhibiting cellular senescence by destabilizing p21(WAF1.). Cell Death Differ. 2013 Aug;20(8):1055-67. doi: 10.1038/cdd.2013.33. Epub 2013 May 3. [Article]
  30. Esteve-Puig R, Gil R, Gonzalez-Sanchez E, Bech-Serra JJ, Grueso J, Hernandez-Losa J, Moline T, Canals F, Ferrer B, Cortes J, Bastian B, Ramon Y Cajal S, Martin-Caballero J, Flores JM, Vivancos A, Garcia-Patos V, Recio JA: A mouse model uncovers LKB1 as an UVB-induced DNA damage sensor mediating CDKN1A (p21WAF1/CIP1) degradation. PLoS Genet. 2014 Oct 16;10(10):e1004721. doi: 10.1371/journal.pgen.1004721. eCollection 2014 Oct. [Article]
  31. Gulbis JM, Kelman Z, Hurwitz J, O'Donnell M, Kuriyan J: Structure of the C-terminal region of p21(WAF1/CIP1) complexed with human PCNA. Cell. 1996 Oct 18;87(2):297-306. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01169Arsenic trioxideapproved, investigationalunknownDetails
DB00313Valproic acidapproved, investigationalunknownregulatorDetails