Streptogramin A acetyltransferase

Details

Name
Streptogramin A acetyltransferase
Synonyms
  • 2.3.1.-
  • satA
  • Vat(D)
  • Virginiamycin acetyltransferase D
Gene Name
vatD
Organism
Enterococcus faecium
Amino acid sequence
>lcl|BSEQ0021973|Streptogramin A acetyltransferase
MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDK
LKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDV
WIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIK
WWNWPIDIINENIDKILDNSIIREVIWKK
Number of residues
209
Molecular Weight
23649.22
Theoretical pI
5.75
GO Classification
Functions
transferase activity, transferring acyl groups
Processes
response to antibiotic
General Function
Transferase activity, transferring acyl groups
Specific Function
Inactivates the A compounds of streptogramin antibiotics by acetylation, thus providing resistance to these antibiotics.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0002464|630 bp
ATGGGTCCGAATCCTATGAAAATGTATCCTATAGAAGGAAACAAATCAGTACAATTTATC
AAACCTATTTTAGAAAAATTAGAAAATGTTGAGGTTGGAGAATACTCATATTATGATTCT
AAGAATGGAGAAACTTTTGATAAGCAAATTTTATATCATTATCCAATCTTAAACGATAAG
TTAAAAATAGGTAAATTTTGCTCAATAGGACCAGGTGTAACTATTATTATGAATGGAGCA
AATCATAGAATGGATGGCTCAACATATCCATTTAATTTATTTGGTAATGGATGGGAGAAA
CATATGCCAAAATTAGATCAACTACCTATTAAGGGGGATACAATAATAGGTAATGATGTA
TGGATAGGAAAAGATGTTGTAATTATGCCAGGAGTAAAAATCGGGGATGGTGCAATAGTA
GCTGCTAATTCTGTTGTTGTAAAAGATATAGCGCCATACATGTTAGCTGGAGGAAATCCT
GCTAACGAAATAAAACAAAGATTTGATCAAGATACAATAAATCAGCTGCTTGATATAAAA
TGGTGGAATTGGCCAATAGACATTATTAATGAGAATATAGATAAAATTCTTGATAATAGC
ATCATTAGAGAAGTCATATGGAAAAAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP50870
UniProtKB Entry NameVATD_ENTFC
GenBank Protein ID433715
GenBank Gene IDL12033
General References
  1. Rende-Fournier R, Leclercq R, Galimand M, Duval J, Courvalin P: Identification of the satA gene encoding a streptogramin A acetyltransferase in Enterococcus faecium BM4145. Antimicrob Agents Chemother. 1993 Oct;37(10):2119-25. [PubMed:8257133]
  2. Sugantino M, Roderick SL: Crystal structure of Vat(D): an acetyltransferase that inactivates streptogramin group A antibiotics. Biochemistry. 2002 Feb 19;41(7):2209-16. [PubMed:11841212]
  3. Kehoe LE, Snidwongse J, Courvalin P, Rafferty JB, Murray IA: Structural basis of Synercid (quinupristin-dalfopristin) resistance in Gram-positive bacterial pathogens. J Biol Chem. 2003 Aug 8;278(32):29963-70. Epub 2003 May 27. [PubMed:12771141]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01669Virginiamycin M1experimentalunknownDetails
DB01992Coenzyme Ainvestigational, nutraceuticalunknownDetails
DB01764DalfopristinapprovedyesinhibitorDetails