Penicillin-binding protein 2X

Details

Name
Penicillin-binding protein 2X
Synonyms
  • PBP-2X
Gene Name
pbpX
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Amino acid sequence
>lcl|BSEQ0011338|Penicillin-binding protein 2X
MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFAVIIGTGTRFGTDLAK
EAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFN
KVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDF
TTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTDGIITYEKDR
LGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQEKVKGKYMTATLVSAKTGE
ILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMKVMMLAAAIDNNTFPGGEVFN
SSELKIADATIRDWDVNEGLTGGRMMTFSQGFAHSSNVGMTLLEQKMGDATWLDYLNRFK
FGVPTRFGLTDEYAGQLPADNIVNIAQSSFGQGISVTQTQMIRAFTAIANDGVMLEPKFI
SAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVLVGTDPVYGTMYNHSTGKPTVTVP
GQNVALKSGTAQIADEKNGGYLVGLTDYIFSAVSMSPAENPDFILYVTVQQPEHYSGIQL
GEFANPILERASAMKDSLNLQTTAKALEQVSQQSPYPMPSVKDISPGDLAEELRRNLVQP
IVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKAEEVPDMYGWTKETAETLAKWLNIELEF
QGSGSTVQKQDVRANTAIKDIKKITLTLGD
Number of residues
750
Molecular Weight
82342.565
Theoretical pI
5.53
GO Classification
Functions
penicillin binding
Processes
cell cycle / cell division / cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
integral component of membrane / plasma membrane
General Function
Penicillin binding
Specific Function
Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Beta-lactams inactivate the PBPs by acylating an essential serine residue in the active site of these proteins.
Pfam Domain Function
Transmembrane Regions
29-49
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0011339|Penicillin-binding protein 2X (pbpX)
ATGAAGTGGACAAAAAGAGTAATCCGTTATGCGACCAAAAATCGGAAATCGCCGGCTGAA
AACAGACGCAGAGTTGGAAAAAGTCTGAGTTTATTATCTGTCTTTGTTTTTGCCATTTTT
TTAGTCAATTTTGCGGTCATTATTGGGACAGGCACTCGCTTTGGAACAGATTTAGCGAAG
GAAGCTAAGAAGGTTCATCAAACCACCCGTACAGTTCCTGCCAAACGTGGGACTATTTAT
GACCGAAATGGAGTCCCGATTGCTGAGGATGCAACCTCTTATAATGTCTATGCGGTCATT
GATGAGAACTATAAGTCAGCAACGGGTAAGATTCTTTACGTAGAAAAAACACAATTTAAC
AAGGTTGCAGAGGTCTTTCATAAGTATCTGGACATGGAAGAATCCTATGTAAGAGAGCAA
CTCTCGCAACCTAATCTCAAGCAAGTTTCCTTTGGAGCAAAGGGAAATGGGATTACCTAT
GCCAATATGATGTCTATCAAAAAAGAATTGGAAGCTGCAGAGGTCAAGGGGATTGATTTT
ACAACCAGTCCCAATCGTAGTTACCCAAACGGACAATTTGCTTCTAGTTTTATCGGCCTA
GCTCAGCTCCATGAAAATGAAGATGGAAGCAAGAGCTTGCTGGGAACCTCTGGAATGGAG
AGTTCCTTGAACAGTATTCTTGCAGGGACAGACGGCATTATTACCTATGAAAAGGATCGT
CTGGGTAATATTGTACCCGGAACAGAACAAGTTTCCCAACGAACGATGGACGGTAAGGAT
GTTTATACAACCATTTCCAGCCCCCTCCAGTCCTTTATGGAAACCCAGATGGATGCTTTT
CAAGAGAAGGTAAAAGGAAAGTACATGACAGCGACTTTGGTCAGTGCTAAAACAGGGGAA
ATTCTGGCAACAACGCAACGACCGACCTTTGATGCAGATACAAAAGAAGGCATTACAGAG
GACTTTGTTTGGCGTGATATCCTTTACCAAAGTAACTATGAGCCAGGTTCCACTATGAAA
GTGATGATGTTGGCTGCTGCTATTGATAATAATACCTTTCCAGGAGGAGAAGTCTTTAAT
AGTAGTGAGTTAAAAATTGCAGATGCCACGATTCGAGATTGGGACGTTAATGAAGGATTG
ACTGGTGGCAGAATGATGACTTTTTCTCAAGGTTTTGCACACTCAAGTAACGTTGGGATG
ACCCTCCTTGAGCAAAAGATGGGAGATGCTACCTGGCTTGATTATCTTAATCGTTTTAAA
TTTGGTGTTCCGACCCGTTTCGGTTTGACGGATGAGTATGCTGGTCAGCTTCCTGCGGAT
AATATTGTCAACATTGCGCAAAGCTCATTTGGACAAGGGATTTCAGTGACCCAGACGCAA
ATGATTCGTGCCTTTACAGCTATTGCTAATGACGGTGTCATGCTGGAGCCTAAATTTATT
AGTGCCATTTATGATCCAAATGATCAAACTGCTCGGAAATCTCAAAAAGAAATTGTGGGA
AATCCTGTTTCTAAAGATGCAGCTAGTCTAACTCGGACTAACATGGTTTTGGTAGGGACG
GATCCGGTTTATGGAACCATGTATAACCACAGCACAGGCAAGCCAACTGTAACTGTTCCT
GGGCAAAATGTAGCCCTCAAGTCTGGTACGGCTCAGATTGCTGACGAGAAAAATGGTGGT
TATCTAGTCGGGTTAACCGACTATATTTTCTCGGCTGTATCGATGAGTCCGGCTGAAAAT
CCTGATTTTATCTTGTATGTGACGGTCCAACAACCTGAACATTATTCAGGTATTCAGTTG
GGAGAATTTGCCAATCCTATCTTGGAGCGGGCTTCAGCTATGAAAGACTCTCTCAATCTT
CAAACAACAGCTAAGGCTTTGGAGCAAGTAAGTCAACAAAGTCCTTATCCTATGCCCAGT
GTCAAGGATATTTCACCTGGTGATTTAGCAGAAGAATTGCGTCGCAATCTTGTACAACCC
ATCGTTGTGGGAACAGGAACGAAGATTAAAAACAGTTCTGCTGAAGAAGGGAAGAATCTT
GCCCCGAACCAGCAAGTCCTTATCTTATCTGATAAAGCAGAGGAGGTTCCAGATATGTAT
GGTTGGACAAAGGAGACTGCTGAGACCCTTGCTAAGTGGCTCAATATAGAACTTGAATTT
CAAGGCTCGGGCTCTACTGTGCAGAAGCAAGATGTTCGTGCTAACACAGCTATCAAGGAC
ATTAAAAAAATTACATTAACTTTAGGAGACTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP59676
UniProtKB Entry NamePBPX_STRR6
GenBank Protein ID47392
GenBank Gene IDX16367
General References
  1. Laible G, Hakenbeck R, Sicard MA, Joris B, Ghuysen JM: Nucleotide sequences of the pbpX genes encoding the penicillin-binding proteins 2x from Streptococcus pneumoniae R6 and a cefotaxime-resistant mutant, C506. Mol Microbiol. 1989 Oct;3(10):1337-48. [Article]
  2. Hoskins J, Alborn WE Jr, Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ, Fuller W, Geringer C, Gilmour R, Glass JS, Khoja H, Kraft AR, Lagace RE, LeBlanc DJ, Lee LN, Lefkowitz EJ, Lu J, Matsushima P, McAhren SM, McHenney M, McLeaster K, Mundy CW, Nicas TI, Norris FH, O'Gara M, Peery RB, Robertson GT, Rockey P, Sun PM, Winkler ME, Yang Y, Young-Bellido M, Zhao G, Zook CA, Baltz RH, Jaskunas SR, Rosteck PR Jr, Skatrud PL, Glass JI: Genome of the bacterium Streptococcus pneumoniae strain R6. J Bacteriol. 2001 Oct;183(19):5709-17. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB031906-o-CapryloylsucroseexperimentalunknownDetails
DB01147Cloxacillinapproved, investigational, vet_approvedyesinhibitorDetails