RNA-directed RNA polymerase L

Details

Name
RNA-directed RNA polymerase L
Synonyms
  • Large structural protein
  • Protein L
  • Replicase
  • Transcriptase
Gene Name
L
Organism
Zaire ebolavirus (strain Mayinga-76)
Amino acid sequence
>lcl|BSEQ0052294|RNA-directed RNA polymerase L
MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNCKLPKHIYRLKYDVTVT
KFLSDVPVATLPIDFIVPVLLKALSGNGFCPVEPRCQQFLDEIIKYTMQDALFLKYYLKN
VGAQEDCVDEHFQEKILSSIQGNEFLHQMFFWYDLAILTRRGRLNRGNSRSTWFVHDDLI
DILGYGDYVFWKIPISMLPLNTQGIPHAAMDWYQASVFKEAVQGHTHIVSVSTADVLIMC
KDLITCRFNTTLISKIAEIEDPVCSDYPNFKIVSMLYQSGDYLLSILGSDGYKIIKFLEP
LCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEITEMRALKPSQAQKIREFHRTLIRLEM
TPQQLCELFSIQKHWGHPVLHSETAIQKVKKHATVLKALRPIVIFETYCVFKYSIAKHYF
DSQGSWYSVTSDRNLTPGLNSYIKRNQFPPLPMIKELLWEFYHLDHPPLFSTKIISDLSI
FIKDRATAVERTCWDAVFEPNVLGYNPPHKFSTKRVPEQFLEQENFSIENVLSYAQKLEY
LLPQYRNFSFSLKEKELNVGRTFGKLPYPTRNVQTLCEALLADGLAKAFPSNMMVVTERE
QKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKN
VFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSIS
CAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVT
SACGIFLKPDETFVHSGFIYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASI
GTAFERSISETRHIFPCRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTIS
LALAVPQVLGGLSFLNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNC
TAIDFVLNPSGLNVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWL
LSSTPVMSRFAADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQ
RWSLWFSYLDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFK
VFWLKPYEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTED
KIGQPAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTP
SHYSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVI
NYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENELI
YDSNPLKGGLNCNISFDNPFFQGKRLNIIEDDLIRLPHLSGWELAKTIMQSIISDSNNSS
TDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYYLTTQIH
NLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLRTSISSFLT
FVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLYQIVELLVHDSSRQQAFKTTISDHVHP
HDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKYLARDSSTGSSTNNSDGHIERSQEQTT
RDPHDGTERNLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGTANPKLNFDRSRHNV
KFQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQDEISKYLRQLRSVIDT
TVYCRFTGIVSSMHYKLDEVLWEIESFKSAVTLAEGEGAGALLLIQKYQVKTLFFNTLAT
ESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQITDITNPTWFKDQRARLPKQ
VEVITMDAETTENINRSKLYEAVYKLILHHIDPSVLKAVVLKVFLSDTEGMLWLNDNLAP
FFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPHQNHLSCKQVILTALQLQIQRSPYW
LSHLTQYADCELHLSYIRLGFPSLEKVLYHRYNLVDSKRGPLVSITQHLAHLRAEIRELT
NDYNQQRQSRTQTYHFIRTAKGRITKLVNDYLKFFLIVQALKHNGTWQAEFKKLPELISV
CNRFYHIRDCNCEERFLVQTLYLHRMQDSEVKLIERLTGLLSLFPDGLYRFD
Number of residues
2212
Molecular Weight
252722.045
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / mRNA (guanine-N7-)-methyltransferase activity / RNA-directed 5'-3' RNA polymerase activity
Processes
negative stranded viral RNA replication / negative stranded viral RNA transcription
Components
host cell cytoplasm / virion
General Function
RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Virion
Gene sequence
>lcl|BSEQ0052295|RNA-directed RNA polymerase L (L)
ATGGCTACACAACATACCCAATACCCAGACGCTAGGTTATCATCACCAATTGTATTGGAC
CAATGTGACCTAGTCACTAGAGCTTGCGGGTTATATTCATCATACTCCCTTAATCCGCAA
CTACGCAACTGTAAACTCCCGAAACATATCTACCGTTTGAAATACGATGTAACTGTTACC
AAGTTCTTGAGTGATGTACCAGTGGCGACATTGCCCATAGATTTCATAGTCCCAGTTCTT
CTCAAGGCACTGTCAGGCAATGGATTCTGTCCTGTTGAGCCGCGGTGCCAACAGTTCTTA
GATGAAATCATTAAGTACACAATGCAAGATGCTCTCTTCTTGAAATATTATCTCAAAAAT
GTGGGTGCTCAAGAAGACTGTGTTGATGAACACTTTCAAGAGAAAATCTTATCTTCAATT
CAGGGCAATGAATTTTTACATCAAATGTTTTTCTGGTATGATCTGGCTATTTTAACTCGA
AGGGGTAGATTAAATCGAGGAAACTCTAGATCAACATGGTTTGTTCATGATGATTTAATA
GACATCTTAGGCTATGGGGACTATGTTTTTTGGAAGATCCCAATTTCAATGTTACCACTG
AACACACAAGGAATCCCCCATGCTGCTATGGACTGGTATCAGGCATCAGTATTCAAAGAA
GCGGTTCAAGGGCATACACACATTGTTTCTGTTTCTACTGCCGACGTCTTGATAATGTGC
AAAGATTTAATTACATGTCGATTCAACACAACTCTAATCTCAAAAATAGCAGAGATTGAG
GATCCAGTTTGTTCTGATTATCCCAATTTTAAGATTGTGTCTATGCTTTACCAGAGCGGA
GATTACTTACTCTCCATATTAGGGTCTGATGGGTATAAAATTATTAAGTTCCTCGAACCA
TTGTGCTTGGCCAAAATTCAATTATGCTCAAAGTACACTGAGAGGAAGGGCCGATTCTTA
ACACAAATGCATTTAGCTGTAAATCACACCCTAGAAGAAATTACAGAAATGCGTGCACTA
AAGCCTTCACAGGCTCAAAAGATCCGTGAATTCCATAGAACATTGATAAGGCTGGAGATG
ACGCCACAACAACTTTGTGAGCTATTTTCCATTCAAAAACACTGGGGGCATCCTGTGCTA
CATAGTGAAACAGCAATCCAAAAAGTTAAAAAACATGCTACGGTGCTAAAAGCATTACGC
CCTATAGTGATTTTCGAGACATACTGTGTTTTTAAATATAGTATTGCCAAACATTATTTT
GATAGTCAAGGATCTTGGTACAGTGTTACTTCAGATAGGAATCTAACACCGGGTCTTAAT
TCTTATATCAAAAGAAATCAATTCCCTCCGTTGCCAATGATTAAAGAACTACTATGGGAA
TTTTACCACCTTGACCACCCTCCACTTTTCTCAACCAAAATTATTAGTGACTTAAGTATT
TTTATAAAAGACAGAGCTACCGCAGTAGAAAGGACATGCTGGGATGCAGTATTCGAGCCT
AATGTTCTAGGATATAATCCACCTCACAAATTTAGTACTAAACGTGTACCGGAACAATTT
TTAGAGCAAGAAAACTTTTCTATTGAGAATGTTCTTTCCTACGCACAAAAACTCGAGTAT
CTACTACCACAATATCGGAACTTTTCTTTCTCATTGAAAGAGAAAGAGTTGAATGTAGGT
AGAACCTTCGGAAAATTGCCTTATCCGACTCGCAATGTTCAAACACTTTGTGAAGCTCTG
TTAGCTGATGGTCTTGCTAAAGCATTTCCTAGCAATATGATGGTAGTTACGGAACGTGAG
CAAAAAGAAAGCTTATTGCATCAAGCATCATGGCACCACACAAGTGATGATTTTGGTGAA
CATGCCACAGTTAGAGGGAGTAGCTTTGTAACTGATTTAGAGAAATACAATCTTGCATTT
AGATATGAGTTTACAGCACCTTTTATAGAATATTGCAACCGTTGCTATGGTGTTAAGAAT
GTTTTTAATTGGATGCATTATACAATCCCACAGTGTTATATGCATGTCAGTGATTATTAT
AATCCACCACATAACCTCACACTGGAGAATCGAGACAACCCCCCCGAAGGGCCTAGTTCA
TACAGGGGTCATATGGGAGGGATTGAAGGACTGCAACAAAAACTCTGGACAAGTATTTCA
TGTGCTCAAATTTCTTTAGTTGAAATTAAGACTGGTTTTAAGTTACGCTCAGCTGTGATG
GGTGACAATCAGTGCATTACTGTTTTATCAGTCTTCCCCTTAGAGACTGACGCAGACGAG
CAGGAACAGAGCGCCGAAGACAATGCAGCGAGGGTGGCCGCCAGCCTAGCAAAAGTTACA
AGTGCCTGTGGAATCTTTTTAAAACCTGATGAAACATTTGTACATTCAGGTTTTATCTAT
TTTGGAAAAAAACAATATTTGAATGGGGTCCAATTGCCTCAGTCCCTTAAAACGGCTACA
AGAATGGCACCATTGTCTGATGCAATTTTTGATGATCTTCAAGGGACCCTGGCTAGTATA
GGCACTGCTTTTGAGCGATCCATCTCTGAGACACGACATATCTTTCCTTGCAGGATAACC
GCAGCTTTCCATACGTTTTTTTCGGTGAGAATCTTGCAATATCATCATCTCGGGTTCAAT
AAAGGTTTTGACCTTGGACAGTTAACACTCGGCAAACCTCTGGATTTCGGAACAATATCA
TTGGCACTAGCGGTACCGCAGGTGCTTGGAGGGTTATCCTTCTTGAATCCTGAGAAATGT
TTCTACCGGAATCTAGGAGATCCAGTTACCTCAGGCTTATTCCAGTTAAAAACTTATCTC
CGAATGATTGAGATGGATGATTTATTCTTACCTTTAATTGCGAAGAACCCTGGGAACTGC
ACTGCCATTGACTTTGTGCTAAATCCTAGCGGATTAAATGTCCCTGGGTCGCAAGACTTA
ACTTCATTTCTGCGCCAGATTGTACGCAGGACCATCACCCTAAGTGCGAAAAACAAACTT
ATTAATACCTTATTTCATGCGTCAGCTGACTTCGAAGACGAAATGGTTTGTAAATGGCTA
TTATCATCAACTCCTGTTATGAGTCGTTTTGCGGCCGATATCTTTTCACGCACGCCGAGC
GGGAAGCGATTGCAAATTCTAGGATACCTGGAAGGAACACGCACATTATTAGCCTCTAAG
ATCATCAACAATAATACAGAGACACCGGTTTTGGACAGACTGAGGAAAATAACATTGCAA
AGGTGGAGCCTATGGTTTAGTTATCTTGATCATTGTGATAATATCCTGGCGGAGGCTTTA
ACCCAAATAACTTGCACAGTTGATTTAGCACAGATTCTGAGGGAATATTCATGGGCTCAT
ATTTTAGAGGGAAGACCTCTTATTGGAGCCACACTCCCATGTATGATTGAGCAATTCAAA
GTGTTTTGGCTGAAACCCTACGAACAATGTCCGCAGTGTTCAAATGCAAAGCAACCAGGT
GGGAAACCATTCGTGTCAGTGGCAGTCAAGAAACATATTGTTAGTGCATGGCCGAACGCA
TCCCGAATAAGCTGGACTATCGGGGATGGAATCCCATACATTGGATCAAGGACAGAAGAT
AAGATAGGACAACCTGCTATTAAACCAAAATGTCCTTCCGCAGCCTTAAGAGAGGCCATT
GAATTGGCGTCCCGTTTAACATGGGTAACTCAAGGCAGTTCGAACAGTGACTTGCTAATA
AAACCATTTTTGGAAGCACGAGTAAATTTAAGTGTTCAAGAAATACTTCAAATGACCCCT
TCACATTACTCAGGAAATATTGTTCACAGGTACAACGATCAATACAGTCCTCATTCTTTC
ATGGCCAATCGTATGAGTAATTCAGCAACGCGATTGATTGTTTCTACAAACACTTTAGGT
GAGTTTTCAGGAGGTGGCCAGTCTGCACGCGACAGCAATATTATTTTCCAGAATGTTATA
AATTATGCAGTTGCACTGTTCGATATTAAATTTAGAAACACTGAGGCTACAGATATCCAA
TATAATCGTGCTCACCTTCATCTAACTAAGTGTTGCACCCGGGAAGTACCAGCTCAGTAT
TTAACATACACATCTACATTGGATTTAGATTTAACAAGATACCGAGAAAACGAATTGATT
TATGACAGTAATCCTCTAAAAGGAGGACTCAATTGCAATATCTCATTCGATAATCCATTT
TTCCAAGGTAAACGGCTGAACATTATAGAAGATGATCTTATTCGACTGCCTCACTTATCT
GGATGGGAGCTAGCCAAGACCATCATGCAATCAATTATTTCAGATAGCAACAATTCATCT
ACAGACCCAATTAGCAGTGGAGAAACAAGATCATTCACTACCCATTTCTTAACTTATCCC
AAGATAGGACTTCTGTACAGTTTTGGGGCCTTTGTAAGTTATTATCTTGGCAATACAATT
CTTCGGACTAAGAAATTAACACTTGACAATTTTTTATATTACTTAACTACTCAAATTCAT
AATCTACCACATCGCTCATTGCGAATACTTAAGCCAACATTCAAACATGCAAGCGTTATG
TCACGGTTAATGAGTATTGATCCTCATTTTTCTATTTACATAGGCGGTGCTGCAGGTGAC
AGAGGACTCTCAGATGCGGCCAGGTTATTTTTGAGAACGTCCATTTCATCTTTTCTTACA
TTTGTAAAAGAATGGATAATTAATCGCGGAACAATTGTCCCTTTATGGATAGTATATCCG
CTAGAGGGTCAAAACCCAACACCTGTGAATAATTTTCTCTATCAGATCGTAGAACTGCTG
GTGCATGATTCATCAAGACAACAGGCTTTTAAAACTACCATAAGTGATCATGTACATCCT
CACGACAATCTTGTTTACACATGTAAGAGTACAGCCAGCAATTTCTTCCATGCATCATTG
GCGTACTGGAGGAGCAGACACAGAAACAGCAACCGAAAATACTTGGCAAGAGACTCTTCA
ACTGGATCAAGCACAAACAACAGTGATGGTCATATTGAGAGAAGTCAAGAACAAACCACC
AGAGATCCACATGATGGCACTGAACGGAATCTAGTCCTACAAATGAGCCATGAAATAAAA
AGAACGACAATTCCACAAGAAAACACGCACCAGGGTCCGTCGTTCCAGTCCTTTCTAAGT
GACTCTGCTTGTGGTACAGCAAATCCAAAACTAAATTTCGATCGATCGAGACACAATGTG
AAATTTCAGGATCATAACTCGGCATCCAAGAGGGAAGGTCATCAAATAATCTCACACCGT
CTAGTCCTACCTTTCTTTACATTATCTCAAGGGACACGCCAATTAACGTCATCCAATGAG
TCACAAACCCAAGACGAGATATCAAAGTACTTACGGCAATTGAGATCCGTCATTGATACC
ACAGTTTATTGTAGATTTACCGGTATAGTCTCGTCCATGCATTACAAACTTGATGAGGTC
CTTTGGGAAATAGAGAGTTTCAAGTCGGCTGTGACGCTAGCAGAGGGAGAAGGTGCTGGT
GCCTTACTATTGATTCAGAAATACCAAGTTAAGACCTTATTTTTCAACACGCTAGCTACT
GAGTCCAGTATAGAGTCAGAAATAGTATCAGGAATGACTACTCCTAGGATGCTTCTACCT
GTTATGTCAAAATTCCATAATGACCAAATTGAGATTATTCTTAACAACTCAGCAAGCCAA
ATAACAGACATAACAAATCCTACTTGGTTTAAAGACCAAAGAGCAAGGCTACCTAAGCAA
GTCGAGGTTATAACCATGGATGCAGAGACAACAGAGAATATAAACAGATCGAAATTGTAC
GAAGCTGTATATAAATTGATCTTACACCATATTGATCCTAGCGTATTGAAAGCAGTGGTC
CTTAAAGTCTTTCTAAGTGATACTGAGGGTATGTTATGGCTAAATGATAATTTAGCCCCG
TTTTTTGCCACTGGTTATTTAATTAAGCCAATAACGTCAAGTGCTAGATCTAGTGAGTGG
TATCTTTGTCTGACGAACTTCTTATCAACTACACGTAAGATGCCACACCAAAACCATCTC
AGTTGTAAACAGGTAATACTTACGGCATTGCAACTGCAAATTCAACGAAGCCCATACTGG
CTAAGTCATTTAACTCAGTATGCTGACTGTGAGTTACATTTAAGTTATATCCGCCTTGGT
TTTCCATCATTAGAGAAAGTACTATACCACAGGTATAACCTCGTCGATTCAAAAAGAGGT
CCACTAGTCTCTATCACTCAGCACTTAGCACATCTTAGAGCAGAGATTCGAGAATTAACT
AATGATTATAATCAACAGCGACAAAGTCGGACTCAAACATATCACTTTATTCGTACTGCA
AAAGGACGAATCACAAAACTAGTCAATGATTATTTAAAATTCTTTCTTATTGTGCAAGCA
TTAAAACATAATGGGACATGGCAAGCTGAGTTTAAGAAATTACCAGAGTTGATTAGTGTG
TGCAATAGGTTCTACCATATTAGAGATTGCAATTGTGAAGAACGTTTCTTAGTTCAAACC
TTATATTTACATAGAATGCAGGATTCTGAAGTTAAGCTTATCGAAAGGCTGACAGGGCTT
CTGAGTTTATTTCCGGATGGTCTCTACAGGTTTGATTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ05318
UniProtKB Entry NameL_EBOZM
General References
  1. Volchkov VE, Volchkova VA, Chepurnov AA, Blinov VM, Dolnik O, Netesov SV, Feldmann H: Characterization of the L gene and 5' trailer region of Ebola virus. J Gen Virol. 1999 Feb;80 ( Pt 2):355-362. doi: 10.1099/0022-1317-80-2-355. [PubMed:10073695]
  2. Sanchez A, Kiley MP, Holloway BP, Auperin DD: Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus. Virus Res. 1993 Sep;29(3):215-40. doi: 10.1016/0168-1702(93)90063-s. [PubMed:8237108]
  3. Trunschke M, Conrad D, Enterlein S, Olejnik J, Brauburger K, Muhlberger E: The L-VP35 and L-L interaction domains reside in the amino terminus of the Ebola virus L protein and are potential targets for antivirals. Virology. 2013 Jul 5;441(2):135-45. doi: 10.1016/j.virol.2013.03.013. Epub 2013 Apr 11. [PubMed:23582637]
  4. Schmidt ML, Hoenen T: Characterization of the catalytic center of the Ebola virus L polymerase. PLoS Negl Trop Dis. 2017 Oct 9;11(10):e0005996. doi: 10.1371/journal.pntd.0005996. eCollection 2017 Oct. [PubMed:28991917]
  5. Tchesnokov EP, Raeisimakiani P, Ngure M, Marchant D, Gotte M: Recombinant RNA-Dependent RNA Polymerase Complex of Ebola Virus. Sci Rep. 2018 Mar 5;8(1):3970. doi: 10.1038/s41598-018-22328-3. [PubMed:29507309]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB14761Remdesivirapproved, investigationalunknowninhibitorDetails
DB11676GalidesivirinvestigationalyesinhibitorDetails
DB15686GS-441524experimentalunknowninhibitorDetails