Jun dimerization protein 2
Details
- Name
- Jun dimerization protein 2
- Synonyms
- Not Available
- Gene Name
- JDP2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0008696|Jun dimerization protein 2 MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE LKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK
- Number of residues
- 163
- Molecular Weight
- 18703.49
- Theoretical pI
- Not Available
- GO Classification
- Functionschromatin binding / protein heterodimerization activity / RNA polymerase II proximal promoter sequence-specific DNA binding / transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA bindingProcessesnegative regulation of fat cell differentiation / positive regulation of histone deacetylation / transcription, DNA-templatedComponentsnucleus
- General Function
- Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin.
- Specific Function
- Chromatin binding
- Pfam Domain Function
- bZIP_1 (PF00170)
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
>lcl|BSEQ0017560|Jun dimerization protein 2 (JDP2) ATGATGCCTGGGCAGATCCCGGACCCTTCGGTGACCACAGGCTCCCTGCCAGGGCTTGGC CCCCTGACCGGGCTCCCCAGCTCGGCCCTGACTGTGGAGGAGCTGAAATACGCTGACATC CGCAACCTCGGGGCCATGATTGCACCCTTGCACTTCCTGGAGGTGAAACTGGGCAAGAGG CCCCAGCCCGTGAAAAGTGAGCTAGATGAGGAAGAGGAGCGAAGGAAAAGGCGCCGGGAG AAGAACAAAGTCGCAGCAGCCCGATGCCGGAACAAGAAGAAGGAGCGCACGGAGTTTCTG CAGCGGGAATCCGAGCGGCTGGAACTCATGAACGCAGAGCTGAAGACCCAGATTGAGGAG CTGAAGCAGGAGCGGCAGCAGCTCATCCTGATGCTGAACCGACACCGCCCCACCTGCATC GTCCGGACCGACAGTGTCAAGACCCCCGAGTCAGAAGGCAACCCACTGCTCGAGCAGCTC GAGAAGAAGTGA
- Chromosome Location
- 14
- Locus
- 14q24.3
- External Identifiers
Resource Link UniProtKB ID Q8WYK2 UniProtKB Entry Name JDP2_HUMAN HGNC ID HGNC:17546 - General References
- Kawaida R, Ohtsuka T, Okutsu J, Takahashi T, Kadono Y, Oda H, Hikita A, Nakamura K, Tanaka S, Furukawa H: Jun dimerization protein 2 (JDP2), a member of the AP-1 family of transcription factor, mediates osteoclast differentiation induced by RANKL. J Exp Med. 2003 Apr 21;197(8):1029-35. [PubMed:12707301]
- Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
- Jin C, Li H, Ugai H, Murata T, Yokoyama KK: Transcriptional regulation of the c-jun gene by AP-1 repressor protein JDP2 during the differentiation of F9 cells. Nucleic Acids Res Suppl. 2002;(2):97-8. [PubMed:12903123]
- Jin C, Kato K, Chimura T, Yamasaki T, Nakade K, Murata T, Li H, Pan J, Zhao M, Sun K, Chiu R, Ito T, Nagata K, Horikoshi M, Yokoyama KK: Regulation of histone acetylation and nucleosome assembly by transcription factor JDP2. Nat Struct Mol Biol. 2006 Apr;13(4):331-8. Epub 2006 Mar 5. [PubMed:16518400]
- Lerdrup M, Holmberg C, Dietrich N, Shaulian E, Herdegen T, Jaattela M, Kallunki T: Depletion of the AP-1 repressor JDP2 induces cell death similar to apoptosis. Biochim Biophys Acta. 2005 Aug 15;1745(1):29-37. [PubMed:16026868]
- Murata T, Shinozuka Y, Obata Y, Yokoyama KK: Phosphorylation of two eukaryotic transcription factors, Jun dimerization protein 2 and activation transcription factor 2, in Escherichia coli by Jun N-terminal kinase 1. Anal Biochem. 2008 May 1;376(1):115-21. doi: 10.1016/j.ab.2008.01.038. Epub 2008 Feb 6. [PubMed:18307971]
- Kimura M: IRF2-binding protein-1 is a JDP2 ubiquitin ligase and an inhibitor of ATF2-dependent transcription. FEBS Lett. 2008 Aug 20;582(19):2833-7. doi: 10.1016/j.febslet.2008.07.033. Epub 2008 Jul 29. [PubMed:18671972]
- Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC: Uncovering global SUMOylation signaling networks in a site-specific manner. Nat Struct Mol Biol. 2014 Oct;21(10):927-36. doi: 10.1038/nsmb.2890. Epub 2014 Sep 14. [PubMed:25218447]
- Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]
- Xiao Z, Chang JG, Hendriks IA, Sigurethsson JO, Olsen JV, Vertegaal AC: System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability. Mol Cell Proteomics. 2015 May;14(5):1419-34. doi: 10.1074/mcp.O114.044792. Epub 2015 Mar 9. [PubMed:25755297]
- Hendriks IA, Lyon D, Young C, Jensen LJ, Vertegaal AC, Nielsen ML: Site-specific mapping of the human SUMO proteome reveals co-modification with phosphorylation. Nat Struct Mol Biol. 2017 Mar;24(3):325-336. doi: 10.1038/nsmb.3366. Epub 2017 Jan 23. [PubMed:28112733]