Solute carrier family 2, facilitated glucose transporter member 8

Details

Name
Solute carrier family 2, facilitated glucose transporter member 8
Synonyms
  • Glucose transporter type 8
  • Glucose transporter type X1
  • GLUT-8
  • GLUT8
  • GLUTX1
Gene Name
SLC2A8
Organism
Humans
Amino acid sequence
>lcl|BSEQ0013546|Solute carrier family 2, facilitated glucose transporter member 8
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPP
APRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDV
WMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLE
WRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGV
IQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVS
AQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLM
AFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR
Number of residues
477
Molecular Weight
50818.54
Theoretical pI
Not Available
GO Classification
Functions
glucose binding / glucose transmembrane transporter activity
Processes
carbohydrate metabolic process / glucose transmembrane transport / glucose transport / insulin receptor signaling pathway / male meiosis I / response to hypoxia / transmembrane transport
Components
cytoplasmic vesicle membrane / integral component of plasma membrane / lysosomal membrane / plasma membrane / synaptic vesicle
General Function
Glucose transmembrane transporter activity
Specific Function
Insulin-regulated facilitative glucose transporter. Binds cytochalasin B in a glucose-inhibitable manner. Seems to be a dual-specific sugar transporter as it is inhibitable by fructose (By similarity).
Pfam Domain Function
Transmembrane Regions
26-46 71-91 97-117 128-148 157-177 183-203 257-277 293-313 320-340 368-388 405-425 439-459
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013547|Solute carrier family 2, facilitated glucose transporter member 8 (SLC2A8)
ATGACGCCCGAGGACCCAGAGGAAACCCAGCCGCTTCTGGGGCCTCCTGGCGGCAGCGCG
CCCCGCGGCCGCCGCGTCTTCCTCGCCGCCTTCGCCGCTGCCCTGGGCCCACTCAGCTTC
GGCTTCGCGCTCGGCTACAGCTCCCCGGCCATCCCTAGCCTGCAGCGCGCCGCGCCCCCG
GCCCCGCGCCTGGACGACGCCGCCGCCTCCTGGTTCGGGGCTGTCGTGACCCTGGGTGCC
GCGGCGGGGGGAGTGCTGGGCGGCTGGCTGGTGGACCGCGCCGGGCGCAAGCTGAGCCTC
TTGCTGTGCTCCGTGCCCTTCGTGGCCGGCTTTGCCGTCATCACCGCGGCCCAGGACGTG
TGGATGCTGCTGGGGGGCCGCCTCCTCACCGGCCTGGCCTGCGGTGTTGCCTCCCTAGTG
GCCCCGGTCTACATCTCCGAAATCGCCTACCCAGCAGTCCGGGGGTTGCTCGGCTCCTGT
GTGCAGCTAATGGTCGTCGTCGGCATCCTCCTGGCCTACCTGGCAGGCTGGGTGCTGGAG
TGGCGCTGGCTGGCTGTGCTGGGCTGCGTGCCCCCCTCCCTCATGCTGCTTCTCATGTGC
TTCATGCCCGAGACCCCGCGCTTCCTGCTGACTCAGCACAGGCGCCAGGAGGCCATGGCC
GCCCTGCGGTTCCTGTGGGGCTCCGAGCAGGGCTGGGAAGACCCCCCCATCGGGGCTGAG
CAGAGCTTTCACCTGGCCCTGCTGCGGCAGCCCGGCATCTACAAGCCCTTCATCATCGGC
GTCTCCCTGATGGCCTTCCAGCAGCTGTCGGGGGTCAACGCCGTCATGTTCTATGCAGAG
ACCATCTTTGAAGAGGCCAAGTTCAAGGACAGCAGCCTGGCCTCGGTCGTCGTGGGTGTC
ATCCAGGTGCTGTTCACAGCTGTGGCGGCTCTCATCATGGACAGAGCAGGGCGGAGGCTG
CTCCTGGTCTTGTCAGGTGTGGTCATGGTGTTCAGCACGAGTGCCTTCGGCGCCTACTTC
AAGCTGACCCAGGGTGGCCCTGGCAACTCCTCGCACGTGGCCATCTCGGCGCCTGTCTCT
GCACAGCCTGTTGATGCCAGCGTGGGGCTGGCCTGGCTGGCCGTGGGCAGCATGTGCCTC
TTCATCGCCGGAGGTCCTCAGGCCCTATGGAGCCTTCTGGCTTGCCTCCGCTTTCTGCAT
CTTCAGTGTCCTTTTCACTTTGTTCTGTGTCCCTGA
Chromosome Location
9
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9NY64
UniProtKB Entry NameGTR8_HUMAN
HGNC IDHGNC:13812
General References
  1. Doege H, Schurmann A, Bahrenberg G, Brauers A, Joost HG: GLUT8, a novel member of the sugar transport facilitator family with glucose transport activity. J Biol Chem. 2000 May 26;275(21):16275-80. [PubMed:10821868]
  2. Ibberson M, Uldry M, Thorens B: GLUTX1, a novel mammalian glucose transporter expressed in the central nervous system and insulin-sensitive tissues. J Biol Chem. 2000 Feb 18;275(7):4607-12. [PubMed:10671487]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09502Fludeoxyglucose (18F)approved, investigationalyessubstrateDetails
DB09341Dextrose, unspecified formapproved, vet_approvedunknownsubstrateDetails
DB01914D-glucoseapproved, investigational, vet_approvednosubstrateDetails