Sodium/potassium-transporting ATPase subunit gamma
Details
- Name
- Sodium/potassium-transporting ATPase subunit gamma
- Kind
- protein
- Synonyms
- ATP1C
- ATP1G1
- FXYD domain-containing ion transport regulator 2
- Na(+)/K(+) ATPase subunit gamma
- Sodium pump gamma chain
- Gene Name
- FXYD2
- UniProtKB Entry
- P54710Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0000457|Sodium/potassium-transporting ATPase subunit gamma MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ INEDEP
- Number of residues
- 66
- Molecular Weight
- 7283.265
- Theoretical pI
- 8.47
- GO Classification
- Functionssodium channel regulator activityProcessesestablishment or maintenance of transmembrane electrochemical gradient / potassium ion import across plasma membrane / transmembrane transportComponentsextracellular exosome / plasma membrane / sodium
- General Function
- May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase
- Specific Function
- Atpase activator activity
- Pfam Domain Function
- ATP1G1_PLM_MAT8 (PF02038)
- Signal Regions
- Not Available
- Transmembrane Regions
- 29-46
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0010020|Sodium/potassium-transporting ATPase subunit gamma (FXYD2) ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTAC TATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTG GGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAA ATCAATGAAGATGAGCCGTAA
- Chromosome Location
- 11
- Locus
- 11q23.3
- External Identifiers
Resource Link UniProtKB ID P54710 UniProtKB Entry Name ATNG_HUMAN GenBank Protein ID 1575004 GenBank Gene ID U50743 GeneCard ID FXYD2 GenAtlas ID FXYD2 HGNC ID HGNC:4026 PDB ID(s) 2MKV, 7E1Z, 7E20, 7E21 KEGG ID hsa:486 NCBI Gene ID 486 - General References
- Kim JW, Lee Y, Lee IA, Kang HB, Choe YK, Choe IS: Cloning and expression of human cDNA encoding Na+, K(+)-ATPase gamma-subunit. Biochim Biophys Acta. 1997 Feb 7;1350(2):133-5. [Article]
- Sweadner KJ, Wetzel RK, Arystarkhova E: Genomic organization of the human FXYD2 gene encoding the gamma subunit of the Na,K-ATPase. Biochem Biophys Res Commun. 2000 Dec 9;279(1):196-201. [Article]
- Meij IC, Koenderink JB, van Bokhoven H, Assink KF, Groenestege WT, de Pont JJ, Bindels RJ, Monnens LA, van den Heuvel LP, Knoers NV: Dominant isolated renal magnesium loss is caused by misrouting of the Na(+),K(+)-ATPase gamma-subunit. Nat Genet. 2000 Nov;26(3):265-6. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Cyclothiazide approved yes target inhibitor Details Thimerosal approved unknown target antagonist Details Potassium gluconate approved no enzyme substrateinducer Details Rubidium Rb-82 approved, investigational no transporter substrate Details