Sodium/potassium-transporting ATPase subunit gamma
Details
- Name
- Sodium/potassium-transporting ATPase subunit gamma
- Synonyms
- ATP1C
- ATP1G1
- FXYD domain-containing ion transport regulator 2
- Na(+)/K(+) ATPase subunit gamma
- Sodium pump gamma chain
- Gene Name
- FXYD2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0000457|Sodium/potassium-transporting ATPase subunit gamma MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ INEDEP
- Number of residues
- 66
- Molecular Weight
- 7283.265
- Theoretical pI
- 8.47
- GO Classification
- Functionsion channel activity / sodium / sodium channel regulator activity / transporter activityProcessesATP hydrolysis coupled transmembrane transport / establishment or maintenance of transmembrane electrochemical gradient / ion transmembrane transport / potassium ion import across plasma membrane / regulation of cell growth / regulation of cell proliferation / regulation of sodium ion transmembrane transporter activity / sodium ion export from cell / transmembrane transport / transportComponentsbasolateral plasma membrane / extracellular exosome / integral component of plasma membrane / intracellular membrane-bounded organelle / plasma membrane / sodium
- General Function
- Transporter activity
- Specific Function
- May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
- Pfam Domain Function
- ATP1G1_PLM_MAT8 (PF02038)
- Transmembrane Regions
- 29-46
- Cellular Location
- Membrane
- Gene sequence
>lcl|BSEQ0010020|Sodium/potassium-transporting ATPase subunit gamma (FXYD2) ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTAC TATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTG GGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAA ATCAATGAAGATGAGCCGTAA
- Chromosome Location
- 11
- Locus
- 11q23
- External Identifiers
Resource Link UniProtKB ID P54710 UniProtKB Entry Name ATNG_HUMAN GenBank Protein ID 1575004 GenBank Gene ID U50743 GenAtlas ID FXYD2 HGNC ID HGNC:4026 - General References
- Kim JW, Lee Y, Lee IA, Kang HB, Choe YK, Choe IS: Cloning and expression of human cDNA encoding Na+, K(+)-ATPase gamma-subunit. Biochim Biophys Acta. 1997 Feb 7;1350(2):133-5. [Article]
- Sweadner KJ, Wetzel RK, Arystarkhova E: Genomic organization of the human FXYD2 gene encoding the gamma subunit of the Na,K-ATPase. Biochem Biophys Res Commun. 2000 Dec 9;279(1):196-201. [Article]
- Meij IC, Koenderink JB, van Bokhoven H, Assink KF, Groenestege WT, de Pont JJ, Bindels RJ, Monnens LA, van den Heuvel LP, Knoers NV: Dominant isolated renal magnesium loss is caused by misrouting of the Na(+),K(+)-ATPase gamma-subunit. Nat Genet. 2000 Nov;26(3):265-6. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00606 Cyclothiazide approved yes inhibitor Details DB11590 Thimerosal approved unknown antagonist Details DB13620 Potassium gluconate approved no substrateinducer Details DB09479 Rubidium Rb-82 approved, investigational no substrate Details DB09020 Bisacodyl approved unknown inhibitor Details DB16690 Tegoprazan investigational yes inhibitor Details DB01250 Olsalazine approved unknown inhibitor Details