30S ribosomal protein S13
Details
- Name
- 30S ribosomal protein S13
- Kind
- protein
- Synonyms
- rps13
- Gene Name
- rpsM
- UniProtKB Entry
- P80377Swiss-Prot
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- NCBI Taxonomy ID
- 300852
- Amino acid sequence
>lcl|BSEQ0012923|30S ribosomal protein S13 MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYV ENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGK KKAPRK
- Number of residues
- 126
- Molecular Weight
- 14304.645
- Theoretical pI
- 11.68
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosome / tRNA bindingProcessestranslationComponentsribosome
- General Function
- Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome structure it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the top of the two subunits; these bridges are in contact with the A site and P site tRNAs respectively and are implicated in movement during ribosome translocation. Separately contacts the tRNAs in the A and P sites.
- Specific Function
- rRNA binding
- Pfam Domain Function
- Ribosomal_S13 (PF00416)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0012924|30S ribosomal protein S13 (rpsM) GTGGCGAGGATCGCAGGGGTAGAGATTCCCAGGAACAAGCGGGTGGACGTCGCCCTCACC TACATCTACGGCATCGGCAAGGCCCGGGCCAAGGAGGCCCTGGAGAAGACGGGGATCAAC CCCGCCACCCGGGTGAAGGACCTCACCGAGGCGGAGGTGGTCCGCCTCCGGGAGTACGTG GAGAACACCTGGAAGCTGGAGGGGGAGCTCAGGGCCGAGGTGGCGGCCAACATCAAGCGC CTCATGGACATCGGCTGCTACCGGGGCCTCCGGCATCGGCGGGGGCTGCCGGTGCGGGGC CAGCGGACCCGCACCAACGCCCGCACCCGCAAGGGGCCCCGCAAGACGGTGGCGGGCAAG AAGAAGGCCCCGAGGAAGTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
- General References
- Wada T, Yamazaki T, Kuramitsu S, Kyogoku Y: Cloning of the RNA polymerase alpha subunit gene from Thermus thermophilus HB8 and characterization of the protein. J Biochem. 1999 Jan;125(1):143-50. [Article]
- Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
- Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
- Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
- Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
- Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
- Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
- Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
- Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
- Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
- Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 2-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATE experimental unknown target Details