30S ribosomal protein S14 type Z

Details

Name
30S ribosomal protein S14 type Z
Kind
protein
Synonyms
  • rpsN
Gene Name
rpsZ
UniProtKB Entry
P0DOY6Swiss-Prot
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
NCBI Taxonomy ID
300852
Amino acid sequence
>lcl|BSEQ0051261|30S ribosomal protein S14 type Z
MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS
W
Number of residues
61
Molecular Weight
7139.57
Theoretical pI
Not Available
GO Classification
Functions
metal ion binding / rRNA binding / structural constituent of ribosome
Processes
translation
Components
ribosome
General Function
Required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site (By similarity). Binds 16S rRNA in center of the 30S subunit head.
Specific Function
rRNA binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0DOY6
UniProtKB Entry NameRS14Z_THET8
PDB ID(s)1FJG, 1HNW, 1HNX, 1HNZ, 1HR0, 1I94, 1I95, 1I96, 1I97, 1IBK, 1IBL, 1IBM, 1J5E, 1JGO, 1JGP, 1JGQ, 1L1U, 1ML5, 1N32, 1N33, 1N34, 1N36, 1VVJ, 1VY4, 1VY5, 1VY6, 1VY7, 1XMO, 1XMQ, 1XNQ, 1XNR, 2E5L, 2F4V, 2HHH, 2UU9, 2UUA, 2UUB, 2UUC, 2UXB, 2UXC, 2UXD, 2VQE, 2VQF, 2ZM6, 3OTO, 3T1H, 3T1Y, 4AQY, 4B3M, 4B3R, 4B3S, 4B3T, 4DR1, 4DR2, 4DR3, 4DR4, 4DR5, 4DR6, 4DR7, 4DUY, 4DUZ, 4DV0, 4DV1, 4DV2, 4DV3, 4DV4, 4DV5, 4DV6, 4DV7, 4GKJ, 4GKK, 4JI0, 4JI1, 4JI2, 4JI3, 4JI4, 4JI5, 4JI6, 4JI7, 4JI8, 4JV5, 4JYA, 4K0K, 4KHP, 4L47, 4L71, 4LEL, 4LF4, 4LF5, 4LF6, 4LF7, 4LF8, 4LF9, 4LFA, 4LFB, 4LFC, 4LFZ, 4LNT, 4LSK, 4LT8, 4NXM, 4NXN, 4OX9, 4P6F, 4P70, 4TUA, 4TUB, 4TUC, 4TUD, 4TUE, 4V42, 4V49, 4V4A, 4V4I, 4V4P, 4V4R, 4V4S, 4V4T, 4V4X, 4V4Y, 4V4Z, 4V51, 4V5A, 4V5C, 4V5D, 4V5E, 4V5F, 4V5G, 4V5J, 4V5K, 4V5L, 4V5M, 4V5N, 4V5P, 4V5Q, 4V5R, 4V5S, 4V68, 4V6A, 4V6F, 4V6G, 4V7J, 4V7K, 4V7L, 4V7M, 4V7W, 4V7X, 4V7Y, 4V7Z, 4V87, 4V8A, 4V8B, 4V8C, 4V8D, 4V8E, 4V8F, 4V8G, 4V8H, 4V8I, 4V8J, 4V8N, 4V8O, 4V8Q, 4V8U, 4V8X, 4V90, 4V95, 4V97, 4V9A, 4V9B, 4V9H, 4V9I, 4V9R, 4V9S, 4W2E, 4W2F, 4W2G, 4W2H, 4W2I, 4W4G, 4WPO, 4WQ1, 4WQF, 4WQR, 4WQU, 4WQY, 4WR6, 4WRA, 4WRO, 4WSD, 4WSM, 4WT1, 4WT8, 4WU1, 4WZD, 4WZO, 4X62, 4X64, 4X65, 4X66, 4Y4O, 4Y4P, 4YHH, 4YPB, 4YY3, 4YZV, 4Z3S, 4Z8C, 4ZER, 4ZSN, 5A9Z, 5AA0, 5BR8, 5CZP, 5D8B, 5DFE, 5DOX, 5DOY, 5E7K, 5E81, 5EL4, 5EL5, 5EL6, 5EL7, 5F8K, 5FDU, 5FDV, 5HAU, 5HCP, 5HCQ, 5HCR, 5HD1, 5IB7, 5IB8, 5IBB, 5IMQ, 5IMR, 5IWA, 5J30, 5J3C, 5J4B, 5J4C, 5J8B, 5LMN, 5LMO, 5LMP, 5LMQ, 5LMR, 5LMS, 5LMT, 5LMU, 5LMV
NCBI Gene ID3169802
General References
  1. Tsiboli P, Choli T: Studies on S14 protein from Thermus thermophilus possessing zinc finger-like motifs. Biol Chem Hoppe Seyler. 1995 Feb;376(2):127-30. [Article]
  2. Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
  3. Tsiboli P, Triantafillidou D, Franceschi F, Choli-Papadopoulou T: Studies on the Zn-containing S14 ribosomal protein from Thermus thermophilus. Eur J Biochem. 1998 Aug 15;256(1):136-41. [Article]
  4. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
  5. Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
  6. Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
  7. Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
  8. Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
  9. Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
  10. Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
  11. Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
  12. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
  13. Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
  14. Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]
  15. Petry S, Brodersen DE, Murphy FV 4th, Dunham CM, Selmer M, Tarry MJ, Kelley AC, Ramakrishnan V: Crystal structures of the ribosome in complex with release factors RF1 and RF2 bound to a cognate stop codon. Cell. 2005 Dec 29;123(7):1255-66. [Article]
  16. Weixlbaumer A, Jin H, Neubauer C, Voorhees RM, Petry S, Kelley AC, Ramakrishnan V: Insights into translational termination from the structure of RF2 bound to the ribosome. Science. 2008 Nov 7;322(5903):953-6. doi: 10.1126/science.1164840. [Article]
  17. Jin H, Kelley AC, Loakes D, Ramakrishnan V: Structure of the 70S ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release. Proc Natl Acad Sci U S A. 2010 May 11;107(19):8593-8. doi: 10.1073/pnas.1003995107. Epub 2010 Apr 26. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
2-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATEexperimentalunknowntargetDetails