30S ribosomal protein S3

Details

Name
30S ribosomal protein S3
Kind
protein
Synonyms
  • rps3
Gene Name
rpsC
UniProtKB Entry
P80372Swiss-Prot
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
NCBI Taxonomy ID
300852
Amino acid sequence
>lcl|BSEQ0012947|30S ribosomal protein S3
MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERA
ADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRV
AEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRA
NIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE
Number of residues
239
Molecular Weight
26700.81
Theoretical pI
11.34
GO Classification
Functions
mRNA binding / rRNA binding / structural constituent of ribosome
Processes
translation
Components
small ribosomal subunit
General Function
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation.
Specific Function
mRNA binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0012948|30S ribosomal protein S3 (rpsC)
ATGGGAAATAAGATCCACCCCATCGGTTTCCGGCTCGGCATCACCCGGGACTGGGAGTCC
CGCTGGTACGCCGGCAAGAAGCAGTACCGCCACCTGCTCCTCGAAGACCAGAGGATCCGG
GGCCTTTTGGAGAAGGAGCTCTACTCGGCGGGCCTCGCCCGGGTGGACATTGAGCGGGCC
GCCGACAACGTGGCCGTGACCGTCCACGTGGCCAAGCCCGGGGTGGTCATCGGCCGGGGT
GGCGAGCGGATCCGGGTGCTCCGGGAGGAGCTGGCCAAGCTCACCGGCAAGAACGTGGCC
CTGAACGTCCAGGAGGTGCAGAACCCCAACCTCTCCGCCCCCCTCGTGGCCCAGCGGGTG
GCGGAGCAGATTGAGCGCCGCTTCGCCGTGCGCCGGGCCATCAAGCAGGCGGTTCAGCGG
GTTATGGAGTCCGGGGCCAAGGGGGCCAAGGTGATCGTCTCCGGCCGCATCGGCGGGGCC
GAGCAGGCGCGCACCGAGTGGGCCGCCCAGGGGCGGGTGCCCCTCCACACCCTGCGTGCT
AACATAGACTACGGCTTTGCCTTGGCCCGGACCACCTACGGCGTCCTCGGGGTCAAGGCC
TACATCTTCCTGGGCGAGGTGATCGGCGGCCAGAAGCCCAAGGCCCGGCCCGAGCTGCCG
AAGGCCGAGGAGAGGCCCCGCCGCCGTCGCCCTGCCGTGCGCGTGAAGAAGGAGGAGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP80372
UniProtKB Entry NameRS3_THET8
GenBank Protein ID55771383
GenBank Gene IDAP008226
PDB ID(s)1FJG, 1HNW, 1HNX, 1HNZ, 1HR0, 1I94, 1I95, 1I96, 1I97, 1IBK, 1IBL, 1IBM, 1J5E, 1L1U, 1ML5, 1N32, 1N33, 1N34, 1N36, 1VVJ, 1VY4, 1VY5, 1VY6, 1VY7, 1XMO, 1XMQ, 1XNQ, 1XNR, 2E5L, 2F4V, 2HHH, 2UU9, 2UUA, 2UUB, 2UUC, 2UXB, 2UXC, 2UXD, 2VQE, 2VQF, 2ZM6, 3OTO, 3T1H, 3T1Y, 4AQY, 4B3M, 4B3R, 4B3S, 4B3T, 4DR1, 4DR2, 4DR3, 4DR4, 4DR5, 4DR6, 4DR7, 4DUY, 4DUZ, 4DV0, 4DV1, 4DV2, 4DV3, 4DV4, 4DV5, 4DV6, 4DV7, 4GKJ, 4GKK, 4JI0, 4JI1, 4JI2, 4JI3, 4JI4, 4JI5, 4JI6, 4JI7, 4JI8, 4JV5, 4JYA, 4K0K, 4KHP, 4L47, 4L71, 4LEL, 4LF4, 4LF5, 4LF6, 4LF7, 4LF8, 4LF9, 4LFA, 4LFB, 4LFC, 4LFZ, 4LNT, 4LSK, 4LT8, 4NXM, 4NXN, 4OX9, 4P6F, 4P70, 4TUA, 4TUB, 4TUC, 4TUD, 4TUE, 4V42, 4V49, 4V4A, 4V4P, 4V4R, 4V4S, 4V4T, 4V4X, 4V4Y, 4V4Z, 4V51, 4V5A, 4V5C, 4V5D, 4V5E, 4V5F, 4V5G, 4V5J, 4V5K, 4V5L, 4V5M, 4V5N, 4V5P, 4V5Q, 4V5R, 4V5S, 4V68, 4V6A, 4V6F, 4V6G, 4V7J, 4V7K, 4V7L, 4V7M, 4V7W, 4V7X, 4V7Y, 4V7Z, 4V87, 4V8A, 4V8B, 4V8C, 4V8D, 4V8E, 4V8F, 4V8G, 4V8H, 4V8I, 4V8J, 4V8N, 4V8O, 4V8Q, 4V8U, 4V8X, 4V90, 4V95, 4V97, 4V9A, 4V9B, 4V9H, 4V9I, 4V9R, 4V9S, 4W2E, 4W2F, 4W2G, 4W2H, 4W2I, 4W4G, 4WPO, 4WQ1, 4WQF, 4WQR, 4WQU, 4WQY, 4WR6, 4WRA, 4WRO, 4WSD, 4WSM, 4WT1, 4WT8, 4WU1, 4WZD, 4WZO, 4X62, 4X64, 4X65, 4X66, 4Y4O, 4Y4P, 4YHH, 4YPB, 4YZV, 4Z3Q, 4Z3R, 4Z3S, 4Z8C, 4ZER, 5A9Z, 5AA0, 5BR8, 5D8B
KEGG IDttj:TTHA1686
NCBI Gene ID3168725
General References
  1. Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
  2. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
  3. Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
  4. Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
  5. Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
  6. Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
  7. Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
  8. Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
  9. Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
  10. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
  11. Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
  12. Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
2-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATEexperimentalunknowntargetDetails