Identification
- Generic Name
- Farletuzumab
- DrugBank Accession Number
- DB05595
- Background
Farletuzumab (MORAb-003) is a fully humanized monoclonal antibody against the folate receptor alpha, for the potential treatment of epithelial ovarian cancer.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>9067_H|farletuzumab|||H-GAMMA-1 (VH(1-119)+CH1(120-217)+HINGE-REGION(218-232)+CH2(233-342)+CH3(343-449))|||||||449||||MW 48946.2|MW 48946.2| EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYY ADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCARHGDDPAWFAYWGQGTPVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>9067_L|farletuzumab|||L-KAPPA (V-KAPPA(1-110)+C-KAPPA(111-217))|||||||217||||MW 23755.2|MW 23755.2| DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVP SRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format- Synonyms
- Farletuzumab
- External IDs
- MORAb-003
Pharmacology
- Indication
Investigated for use/treatment in ovarian cancer.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
Avoid life-threatening adverse drug eventsImprove clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.- Pharmacodynamics
Not Available
- Mechanism of action
Target Actions Organism AFolate receptor alpha antibodyHumans - Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Farletuzumab. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Farletuzumab. Aducanumab The risk or severity of adverse effects can be increased when Farletuzumab is combined with Aducanumab. Alemtuzumab The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Farletuzumab. Alirocumab The risk or severity of adverse effects can be increased when Farletuzumab is combined with Alirocumab. Amivantamab The risk or severity of adverse effects can be increased when Farletuzumab is combined with Amivantamab. Anifrolumab The risk or severity of adverse effects can be increased when Farletuzumab is combined with Anifrolumab. Ansuvimab The risk or severity of adverse effects can be increased when Farletuzumab is combined with Ansuvimab. Anthrax immune globulin human The risk or severity of adverse effects can be increased when Farletuzumab is combined with Anthrax immune globulin human. Antilymphocyte immunoglobulin (horse) The risk or severity of adverse effects can be increased when Farletuzumab is combined with Antilymphocyte immunoglobulin (horse). 
Identify potential medication risksEasily compare up to 40 drugs with our drug interaction checker.Get severity rating, description, and management advice.Learn more - Food Interactions
- Not Available
Categories
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- 2O09BG0OWA
- CAS number
- 896723-44-7
References
- General References
- Not Available
- External Links
- KEGG Drug
- D09343
- PubChem Substance
- 347910184
- Wikipedia
- Farletuzumab
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 3 Terminated Treatment Ovarian Cancer 1 2 Completed Treatment Abdominal wall neoplasm / Fallopian Tube Cancer / Ovarian Cancer 1 2 Completed Treatment Adenocarcinoma of the Lung 1 2 Completed Treatment Platinum-Sensitive Ovarian Cancer in First Relapse 1 2 Terminated Treatment Epithelial Ovarian Cancer 1 2 Terminated Treatment Ovarian Cancer 1 2 Withdrawn Treatment Resectable, Non-functioning Pituitary Adenoma 1 1 Completed Not Available Epithelial Ovarian Cancer 1 1 Completed Treatment Epithelial Ovarian Cancer 1 1 Completed Treatment Neoplasm / Solid Tumors 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
- Not Available
Targets
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock newinsights and accelerate drug research.
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Antibody
- General Function
- Receptor activity
- Specific Function
- Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analo...
- Gene Name
- FOLR1
- Uniprot ID
- P15328
- Uniprot Name
- Folate receptor alpha
- Molecular Weight
- 29818.94 Da
References
- Kalli KR: MORAb-003, a fully humanized monoclonal antibody against the folate receptor alpha, for the potential treatment of epithelial ovarian cancer. Curr Opin Investig Drugs. 2007 Dec;8(12):1067-73. [Article]
Drug created at November 18, 2007 18:26 / Updated at January 14, 2023 19:03