Farletuzumab

Identification

Generic Name
Farletuzumab
DrugBank Accession Number
DB05595
Background

Farletuzumab (MORAb-003) is a fully humanized monoclonal antibody against the folate receptor alpha, for the potential treatment of epithelial ovarian cancer.

Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db05595
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>9067_H|farletuzumab|||H-GAMMA-1 (VH(1-119)+CH1(120-217)+HINGE-REGION(218-232)+CH2(233-342)+CH3(343-449))|||||||449||||MW 48946.2|MW 48946.2|
EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAMISSGGSYTYY
ADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCARHGDDPAWFAYWGQGTPVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>9067_L|farletuzumab|||L-KAPPA (V-KAPPA(1-110)+C-KAPPA(111-217))|||||||217||||MW 23755.2|MW 23755.2|
DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIYGTSNLASGVP
SRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS
TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Farletuzumab
External IDs
  • MORAb-003

Pharmacology

Indication

Investigated for use/treatment in ovarian cancer.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Not Available

Mechanism of action
TargetActionsOrganism
AFolate receptor alpha
antibody
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Farletuzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Farletuzumab.
AducanumabThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Farletuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Alirocumab.
AmivantamabThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Amivantamab.
AnifrolumabThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Anifrolumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Farletuzumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Farletuzumab is combined with Antilymphocyte immunoglobulin (horse).
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
Not Available

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
2O09BG0OWA
CAS number
896723-44-7

References

General References
Not Available
KEGG Drug
D09343
PubChem Substance
347910184
Wikipedia
Farletuzumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3CompletedTreatmentOvarian Cancer1
2CompletedTreatmentAbdominal wall neoplasm / Fallopian Tubes Cancer / Ovarian Cancer1
2CompletedTreatmentAdenocarcinoma of Lung (Disorder)1
2CompletedTreatmentOvarian Cancer (Epithelial)1
2CompletedTreatmentPlatinum-Sensitive Ovarian Cancer in First Relapse1
2TerminatedTreatmentOvarian Cancer1
2WithdrawnTreatmentResectable, Non-functioning Pituitary Adenoma1
1CompletedNot AvailableOvarian Cancer (Epithelial)1
1CompletedTreatmentNeoplasms / Tumors, Solid1
1CompletedTreatmentOvarian Cancer (Epithelial)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Receptor activity
Specific Function
Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analo...
Gene Name
FOLR1
Uniprot ID
P15328
Uniprot Name
Folate receptor alpha
Molecular Weight
29818.94 Da
References
  1. Kalli KR: MORAb-003, a fully humanized monoclonal antibody against the folate receptor alpha, for the potential treatment of epithelial ovarian cancer. Curr Opin Investig Drugs. 2007 Dec;8(12):1067-73. [Article]

Drug created on November 18, 2007 18:26 / Updated on February 21, 2021 18:51