Alemtuzumab

Identification

Name
Alemtuzumab
Accession Number
DB00087
Description

Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db00087
Protein Chemical Formula
C6468H10066N1732O2005S40
Protein Average Weight
145453.8 Da
Sequences
>1CE1:H CAMPATH-1H:Heavy Chain 1
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1CE1:L CAMPATH-1H:Light Chain 1
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1CE1:H CAMPATH-1H:Heavy Chain 2
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1CE1:L CAMPATH-1H:Light Chain 2
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1bey_H|CAMPATH-1H|Humanized||VH-CH1 (VH(1-121)+CH1(122-210))|||||||219||||MW 23397.3|MW 23397.3|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
>1bey_L|CAMPATH-1H|Humanized||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-214))|||||||214||||MW 23571.3|MW 23571.3|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>8005_H|alemtuzumab|||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-220)+CH2(221-330)+CH3(331-437))|||||||437||||MW 47976.2|MW 47976.2|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEAPELLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPGK
>8005_L|alemtuzumab|||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-214))|||||||214||||MW 23571.3|MW 23571.3|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>1ce1_H|CAMPATH-1H|Humanized||VH-CH1 (VH(1-121)+CH1(122-219))|||||||220||||MW 23526.4|MW 23526.4|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
>1ce1_L|CAMPATH-1H|Humanized||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-211))|||||||211||||MW 23282.0|MW 23282.0|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Download FASTA Format
Synonyms
Not Available

Pharmacology

Indication

Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.

Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.

Mechanism of action

Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.

TargetActionsOrganism
ACAMPATH-1 antigen
antibody
Humans
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHumans
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHumans
Absorption
Not Available
Volume of distribution
  • 0.18 L/kg
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes

Route of elimination
Not Available
Half-life

~288 hrs

Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbataceptThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Alemtuzumab.
AcenocoumarolThe risk or severity of bleeding can be increased when Acenocoumarol is combined with Alemtuzumab.
Acetylsalicylic acidThe risk or severity of bleeding can be increased when Acetylsalicylic acid is combined with Alemtuzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Alemtuzumab.
Adenovirus type 7 vaccine liveThe risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Alemtuzumab.
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Alemtuzumab.
AlefaceptThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Alefacept.
AlirocumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Alirocumab.
AllopurinolThe risk or severity of adverse effects can be increased when Allopurinol is combined with Alemtuzumab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
CampathInjection30 mg/1mLIntravenousBayer2009-04-202011-10-31US flag
CampathInjection30 mg/1mLIntravenousGenzyme Corporation2009-11-30Not applicableUS flag
LemtradaInjection, solution, concentrate12 mg/1.2mLIntravenousGenzyme Corporation2014-11-18Not applicableUS flag
LemtradaSolution12 mgIntravenousSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2014-01-29Not applicableCanada flag
MabcampathSolutionIntravenousGenzyme Corporation2006-05-012008-08-07Canada flag
MabcampathSolutionIntravenousSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2007-09-07Not applicableCanada flag
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
L04AA34 — Alemtuzumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
3A189DH42V
CAS number
216503-57-0

References

General References
  1. Hale G, Bright S, Chumbley G, Hoang T, Metcalf D, Munro AJ, Waldmann H: Removal of T cells from bone marrow for transplantation: a monoclonal antilymphocyte antibody that fixes human complement. Blood. 1983 Oct;62(4):873-82. [PubMed:6349718]
  2. Riechmann L, Clark M, Waldmann H, Winter G: Reshaping human antibodies for therapy. Nature. 1988 Mar 24;332(6162):323-7. [PubMed:3127726]
PubChem Substance
46507379
RxNav
117055
ChEMBL
CHEMBL1201587
Therapeutic Targets Database
DAP000385
PharmGKB
PA164783958
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Alemtuzumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
MSDS
Download (39.4 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4Active Not RecruitingTreatmentDisseminated Sclerosis1
4Active Not RecruitingTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
4CompletedNot AvailableEnd Stage Renal Disease (ESRD) / Living Donors1
4CompletedPreventionRejection, Transplant1
4CompletedPreventionTransplant; Failure, Kidney1
4CompletedTreatmentDisseminated Sclerosis1
4CompletedTreatmentLiving-Donor Kidney Transplants1
4CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
4CompletedTreatmentTransplantation, Kidney1
4CompletedTreatmentTransplantation, Renal2

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Bayer Healthcare
  • Boehringer Ingelheim Ltd.
  • Genzyme Inc.
  • ILEX Pharmaceuticals LP
Dosage Forms
FormRouteStrength
InjectionIntravenous30 mg/1mL
Injection, solution, concentrateIntravenous12 mg/1.2mL
Injection, solution, concentrateIntravenous; Parenteral12 MG
Injection, solution, concentrate12 mg/1.2ml
Injection, solution
SolutionIntravenous12 mg
SolutionIntravenous
SolutionIntravenous30 mg/ml
Prices
Unit descriptionCostUnit
Campath 30 mg/ml Solution (1 Box Contains Three 1ml Vials)6179.24USD box
Campath 30 mg/ml vial2042.18USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
CA1339198No1997-08-052014-08-05Canada flag
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.431Not Available
isoelectric point8.76Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Not Available
Specific Function
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Gene Name
CD52
Uniprot ID
P31358
Uniprot Name
CAMPATH-1 antigen
Molecular Weight
6613.67 Da
References
  1. Gilliland LK, Walsh LA, Frewin MR, Wise MP, Tone M, Hale G, Kioussis D, Waldmann H: Elimination of the immunogenicity of therapeutic antibodies. J Immunol. 1999 Mar 15;162(6):3663-71. [PubMed:10092828]
  2. James LC, Hale G, Waldmann H, Bloomer AC: 1.9 A structure of the therapeutic antibody CAMPATH-1H fab in complex with a synthetic peptide antigen. J Mol Biol. 1999 Jun 4;289(2):293-301. [PubMed:10366506]
  3. Rawstron AC, Rollinson SJ, Richards S, Short MA, English A, Morgan GJ, Hale G, Hillmen P: The PNH phenotype cells that emerge in most patients after CAMPATH-1H therapy are present prior to treatment. Br J Haematol. 1999 Oct;107(1):148-53. [PubMed:10520035]
  4. Rebello PR, Hale G, Friend PJ, Cobbold SP, Waldmann H: Anti-globulin responses to rat and humanized CAMPATH-1 monoclonal antibody used to treat transplant rejection. Transplantation. 1999 Nov 15;68(9):1417-20. [PubMed:10573085]
  5. Hederer RA, Guntermann C, Miller N, Nagy P, Szollosi J, Damjanovich S, Hale G, Alexander DR: The CD45 tyrosine phosphatase regulates Campath-1H (CD52)-induced TCR-dependent signal transduction in human T cells. Int Immunol. 2000 Apr;12(4):505-16. [PubMed:10744652]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  7. Geissinger E, Bonzheim I, Roth S, Rosenwald A, Muller-Hermelink HK, Rudiger T: CD52 expression in peripheral T-cell lymphomas determined by combined immunophenotyping using tumor cell specific T-cell receptor antibodies. Leuk Lymphoma. 2009 Jun;50(6):1010-6. doi: 10.1080/10428190902926981. [PubMed:19479612]
  8. Quintas-Cardama A, O'Brien S: Targeted therapy for chronic lymphocytic leukemia. Target Oncol. 2009 Jan;4(1):11-21. doi: 10.1007/s11523-008-0099-0. Epub 2009 Jan 27. [PubMed:19343298]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Nagler A, Condiotti R, Lubina A, Deutsch VR: Enhancement of megakaryocytopoiesis by Campath-1G-treated natural killer cells. Bone Marrow Transplant. 1997 Oct;20(7):525-31. [PubMed:9337053]
  2. Brett S, Baxter G, Cooper H, Johnston JM, Tite J, Rapson N: Repopulation of blood lymphocyte sub-populations in rheumatoid arthritis patients treated with the depleting humanized monoclonal antibody, CAMPATH-1H. Immunology. 1996 May;88(1):13-9. [PubMed:8707338]
  3. Osterborg A, Werner A, Halapi E, Lundin J, Harmenberg U, Wigzell H, Mellstedt H: Clonal CD8+ and CD52- T cells are induced in responding B cell lymphoma patients treated with Campath-1H (anti-CD52). Eur J Haematol. 1997 Jan;58(1):5-13. [PubMed:9020367]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Lin TS, Flinn IW, Modali R, Lehman TA, Webb J, Waymer S, Moran ME, Lucas MS, Farag SS, Byrd JC: FCGR3A and FCGR2A polymorphisms may not correlate with response to alemtuzumab in chronic lymphocytic leukemia. Blood. 2005 Jan 1;105(1):289-91. Epub 2004 Jun 24. [PubMed:15217834]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. White AL, Chan HT, French RR, Beers SA, Cragg MS, Johnson PW, Glennie MJ: FcgammaRIotaIotaB controls the potency of agonistic anti-TNFR mAbs. Cancer Immunol Immunother. 2013 May;62(5):941-8. doi: 10.1007/s00262-013-1398-6. Epub 2013 Mar 31. [PubMed:23543215]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Lin TS, Flinn IW, Modali R, Lehman TA, Webb J, Waymer S, Moran ME, Lucas MS, Farag SS, Byrd JC: FCGR3A and FCGR2A polymorphisms may not correlate with response to alemtuzumab in chronic lymphocytic leukemia. Blood. 2005 Jan 1;105(1):289-91. Epub 2004 Jun 24. [PubMed:15217834]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. White AL, Chan HT, French RR, Beers SA, Cragg MS, Johnson PW, Glennie MJ: FcgammaRIotaIotaB controls the potency of agonistic anti-TNFR mAbs. Cancer Immunol Immunother. 2013 May;62(5):941-8. doi: 10.1007/s00262-013-1398-6. Epub 2013 Mar 31. [PubMed:23543215]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. White AL, Chan HT, French RR, Beers SA, Cragg MS, Johnson PW, Glennie MJ: FcgammaRIotaIotaB controls the potency of agonistic anti-TNFR mAbs. Cancer Immunol Immunother. 2013 May;62(5):941-8. doi: 10.1007/s00262-013-1398-6. Epub 2013 Mar 31. [PubMed:23543215]

Drug created on June 13, 2005 07:24 / Updated on October 26, 2020 22:40

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates