Veltuzumab
This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.
Identification
- Name
- Veltuzumab
- Accession Number
- DB05656
- Description
Veltuzumab is a monoclonal antibody which, as of October 2009, is undergoing Phase I/II clinical trials for the treatment of non-Hodgkin's lymphoma.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) - Protein Structure
- Protein Chemical Formula
- C6458H9918N1706O2026S46
- Protein Average Weight
- Not Available
- Sequences
>8932_H|veltuzumab|Humanized||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49467.6|MW 49467.6| QVQLQQSGAEVKKPGSSVKVSCKASGYTFTSYNMHWVKQAPGQGLEWIGAIYPGNGDTSY NQKFKGKATLTADESTNTAYMELSSLRSEDTAFYYCARSTYYGGDWYFDVWGQGTTVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8932_L|veltuzumab|Humanized||L-KAPPA (V-KAPPA(1-106)+C-KAPPA(107-213))|||||||213||||MW 23205.8|MW 23205.8| DIQLTQSPSSLSASVGDRVTMTCRASSSVSYIHWFQQKPGKAPKPWIYATSNLASGVPVR FSGSGSGTDYTFTISSLQPEDIATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format- Synonyms
- Veltuzumab
- External IDs
- hA20
- IMMU-106
Pharmacology
- Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:Accelerate your drug discovery research with our fully connected ADMET dataset
- Indication
Investigated for use/treatment in lymphoma (non-hodgkin's).
- Contraindications & Blackbox Warnings
- Contraindications & Blackbox WarningsWith our commercial data, access important information on dangerous risks, contraindications, and adverse effects.Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
- Pharmacodynamics
- Not Available
- Mechanism of action
- Not Available
- Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half-life
- Not Available
- Clearance
- Not Available
- Adverse Effects
- Reduce medical errorsand improve treatment outcomes with our comprehensive & structured data on drug adverse effects.Reduce medical errors & improve treatment outcomes with our adverse effects data
- Toxicity
- Not Available
- Affected organisms
- Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Veltuzumab. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Veltuzumab. Alemtuzumab The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Veltuzumab. Alirocumab The risk or severity of adverse effects can be increased when Veltuzumab is combined with Alirocumab. Ansuvimab The risk or severity of adverse effects can be increased when Veltuzumab is combined with Ansuvimab. Anthrax immune globulin human The risk or severity of adverse effects can be increased when Veltuzumab is combined with Anthrax immune globulin human. Antilymphocyte immunoglobulin (horse) The risk or severity of adverse effects can be increased when Veltuzumab is combined with Antilymphocyte immunoglobulin (horse). Antithymocyte immunoglobulin (rabbit) The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Veltuzumab. Asfotase alfa The risk or severity of adverse effects can be increased when Veltuzumab is combined with Asfotase alfa. Atezolizumab The risk or severity of adverse effects can be increased when Veltuzumab is combined with Atezolizumab. Improve patient outcomesBuild effective decision support tools with the industry’s most comprehensive drug-drug interaction checker.Learn more - Food Interactions
- Not Available
Categories
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Chemical Identifiers
- UNII
- BPD4DGQ314
- CAS number
- 728917-18-8
References
- General References
- Not Available
- External Links
- Wikipedia
- Veltuzumab
Clinical Trials
- Clinical Trials
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Drug created on November 18, 2007 18:26 / Updated on February 21, 2021 18:51