Veltuzumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Name
Veltuzumab
Accession Number
DB05656
Description

Veltuzumab is a monoclonal antibody which, as of October 2009, is undergoing Phase I/II clinical trials for the treatment of non-Hodgkin's lymphoma.

Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db05656
Protein Chemical Formula
C6458H9918N1706O2026S46
Protein Average Weight
Not Available
Sequences
>8932_H|veltuzumab|Humanized||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49467.6|MW 49467.6|
QVQLQQSGAEVKKPGSSVKVSCKASGYTFTSYNMHWVKQAPGQGLEWIGAIYPGNGDTSY
NQKFKGKATLTADESTNTAYMELSSLRSEDTAFYYCARSTYYGGDWYFDVWGQGTTVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8932_L|veltuzumab|Humanized||L-KAPPA (V-KAPPA(1-106)+C-KAPPA(107-213))|||||||213||||MW 23205.8|MW 23205.8|
DIQLTQSPSSLSASVGDRVTMTCRASSSVSYIHWFQQKPGKAPKPWIYATSNLASGVPVR
FSGSGSGTDYTFTISSLQPEDIATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
  • hA20
  • IMMU-106

Pharmacology

Indication

Investigated for use/treatment in lymphoma (non-hodgkin's).

Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics
Not Available
Mechanism of action
Not Available
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half-life
Not Available
Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Veltuzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Veltuzumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Veltuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Alirocumab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Veltuzumab is combined with Antilymphocyte immunoglobulin (horse).
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Veltuzumab.
Asfotase alfaThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Asfotase alfa.
AtezolizumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Atezolizumab.
AvelumabThe risk or severity of adverse effects can be increased when Veltuzumab is combined with Avelumab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
BPD4DGQ314
CAS number
728917-18-8

References

General References
Not Available
Wikipedia
Veltuzumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
2TerminatedTreatmentRheumatoid Arthritis1
1, 2Active Not RecruitingTreatmentAggressive NHL / Diffuse Large B-Cell Lymphoma (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Leukemia, B-Cell, Chronic / Leukemia, Prolymphocytic / Leukemia, Small Lymphocytic / Lymphoma, B-Cell / Lymphoma, Intermediate-Grade / Lymphoma, Large-Cell / Lymphoma, Low-Grade / Lymphoma, Lymphoplasmacytoid, CLL / Lymphoma, Mixed-Cell / Lymphoma, Small-Cell / Lymphoplasmacytoid Lymphoma, CLL / Non-Hodgkin's Lymphoma (NHL) / Small Lymphocytic Lymphoma1
1, 2CompletedTreatmentLymphoma, Diffuse / Lymphoma, Diffuse, Mixed Lymphocytic-Histiocytic / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentMalignant Lymphomas1
1, 2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2TerminatedTreatmentAutoimmune Thrombocytopenic Purpura / Idiopathic Thrombocytopenic Purpura / Purpura, Thrombocytopenic, Autoimmune1
1, 2TerminatedTreatmentFollicular Lymphoma (FL)1
1, 2Unknown StatusTreatmentRecurrent or Refractory B Cell Acute Lymphoblastic Leukaemia1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Drug created on November 18, 2007 11:26 / Updated on June 12, 2020 10:52

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates