Motavizumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Generic Name
Motavizumab
DrugBank Accession Number
DB06310
Background

Not Available

Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db06310
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>8693_H|motavizumab|Humanized||H-GAMMA-1 (VH(1-120)+CH1(121-218)+HINGE-REGION(219-233)+CH2(234-343)+CH3(344-450))|||||||450||||MW 49607.2|MW 49607.2|
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKH
YNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8693_L|motavizumab|Humanized||L-KAPPA (V-KAPPA(1-106)+C-KAPPA(107-213))|||||||213||||MW 23127.7|MW 23127.7|
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKH
YNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • Motavizumab
External IDs
  • MEDI 524
  • MEDI-524

Pharmacology

Indication

Investigated for use/treatment in viral infection and pediatric indications.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Not Available

Mechanism of action

Motavizumab is a second generation, ultra-potent, affinity-matured, humanized mAb derived from palivizumab that reduces replication of Respiratory Syncytial Virus (RSV), a pathogen which causes lower respiratory tract disease.

Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Motavizumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Motavizumab.
AducanumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Motavizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Alirocumab.
AmivantamabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Amivantamab.
AnifrolumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Anifrolumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Motavizumab is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Motavizumab is combined with Antilymphocyte immunoglobulin (horse).
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
Not Available

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
International/Other Brands
Numax

Categories

ATC Codes
J06BB17 — Motavizumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
50Y163LK8Q
CAS number
677010-34-3

References

General References
  1. Wu H, Pfarr DS, Johnson S, Brewah YA, Woods RM, Patel NK, White WI, Young JF, Kiener PA: Development of motavizumab, an ultra-potent antibody for the prevention of respiratory syncytial virus infection in the upper and lower respiratory tract. J Mol Biol. 2007 May 4;368(3):652-65. Epub 2007 Feb 20. [Article]
Wikipedia
Motavizumab

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3CompletedPreventionInfections, Respiratory Syncytial Virus1
3CompletedTreatmentHealthy Subjects (HS)1
3WithdrawnTreatmentWheezing1
2CompletedPreventionChronic Lung Disease and <= 24 Months of Age or / Infections, Respiratory Syncytial Virus / Premature With Gestational Age <=35 Weeks and <=6 Months of Age1
2CompletedPreventionCongenital Heart Disease (CHD)1
2TerminatedPreventionParticipants Less Than 12 Months of Age With RSV Illness1
1CompletedPreventionInfections, Respiratory Syncytial Virus1
1CompletedTreatmentHealthy Subjects (HS)1
1CompletedTreatmentRespiratory Syncytial Virus Prophylaxis1
1, 2CompletedPreventionMotavizumab Administration for a Second Season for RSV Prophylaxis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Drug created on March 19, 2008 16:23 / Updated on February 21, 2021 18:52