Identification

Summary

Tetanus immune globulin is a solution of antibodies used to prevent tetanus after an injury.

Brand Names
Hypertet
Generic Name
Tetanus immune globulin, human
Commonly known or available as Tetanus immune globulin
DrugBank Accession Number
DB11604
Background

Tetanus Immune Globulin is manufactured from human plasma Label. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Polyclonal antibody (pAb)
Protein Structure
Db11604
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>1AQK:H|PDBID|CHAIN|SEQUENCE
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYY
ADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Download FASTA Format
Synonyms
  • Human clostridium tetani immune globulin
  • Human clostridium tetani toxoid immune globulin
  • Tetanus immune globulin human
  • Tetanus immune globulin,human
  • Tetanus immunoglobulin
  • Tetanus immunoglobulin (human)

Pharmacology

Indication

For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status Label. May also be used in the treatment of active tetanus.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus Label.

Mechanism of action

The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction 1. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.

TargetActionsOrganism
ATetanus toxin
antibody
Clostridium tetani (strain Massachusetts / E88)
Absorption

Tmax for intramuscular administration is 2 days Label.

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Half life is about 23 days Label.

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted Label.

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tetanus immune globulin, human.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Tetanus immune globulin, human.
AducanumabThe risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Tetanus immune globulin, human.
AlirocumabThe risk or severity of adverse effects can be increased when Alirocumab is combined with Tetanus immune globulin, human.
AmivantamabThe risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Amivantamab.
AnifrolumabThe risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Anifrolumab.
AnsuvimabThe risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Anthrax immune globulin human is combined with Tetanus immune globulin, human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Antilymphocyte immunoglobulin (horse) is combined with Tetanus immune globulin, human.
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
No interactions found.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Hyper TetLiquid16.5 %IntramuscularCutter Med & Biol, Division Of Miles Canada Ltd.1959-12-311998-09-25Canada flag
HyperTETInjection250 [iU]/1mLIntramuscularGRIFOLS USA, LLC1996-08-14Not applicableUS flag
HyperTETSolution250 unit / mLIntramuscularGrifols Therapeutics LlcNot applicableNot applicableCanada flag
Hypertet S/dSolution250 unit/1IntramuscularGrifols Therapeutics LlcNot applicableNot applicableCanada flag
Hypertet S/dSolution250 [iU] /mLIntramuscularGrifols Therapeutics Llc1997-07-08Not applicableCanada flag

Categories

ATC Codes
J06BB02 — Tetanus immunoglobulin
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
V4SWI4RF4J
CAS number
Not Available

References

General References
  1. Hassel B: Tetanus: pathophysiology, treatment, and the possibility of using botulinum toxin against tetanus-induced rigidity and spasms. Toxins (Basel). 2013 Jan 8;5(1):73-83. doi: 10.3390/toxins5010073. [Article]
PubChem Substance
347911214
RxNav
91603
FDA label
Download (196 KB)
MSDS
Download (44.8 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4TerminatedPreventionTetanus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
SolutionIntramuscular250 IU
LiquidIntramuscular16.5 %
InjectionIntramuscular250 [iU]/1mL
SolutionIntramuscular250 unit / mL
SolutionIntramuscular250 unit/1
SolutionIntramuscular250 [iU] /mL
InjectionIntramuscular250 units
Injection, solutionIntramuscular; Parenteral250 IU/1ML
Injection, solutionIntramuscular; Parenteral500 IU/2ML
InjectionIntramuscular250 iu/ml
InjectionIntramuscular500 iu/2ml
Injection, solution
InjectionIntramuscular
Injection, powder, for solution
Injection, solutionIntramuscular
Injection, solutionIntramuscular; Parenteral250 U.I./2ML
Injection, solutionIntramuscular; Parenteral500 U.I.
Powder, for solutionIntravenous
SolutionIntramuscular250 iu/1ml
SolutionIntramuscular125 iu/1ml
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Clostridium tetani (strain Massachusetts / E88)
Pharmacological action
Yes
Actions
Antibody
General Function
Zinc ion binding
Specific Function
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can ...
Gene Name
tetX
Uniprot ID
P04958
Uniprot Name
Tetanus toxin
Molecular Weight
150680.98 Da

Drug created at June 01, 2016 20:56 / Updated at November 28, 2021 16:22