Identification
- Summary
Tetanus immune globulin is a solution of antibodies used to prevent tetanus after an injury.
- Brand Names
- Hypertet
- Generic Name
- Tetanus immune globulin, human
Commonly known or available as Tetanus immune globulin - DrugBank Accession Number
- DB11604
- Background
Tetanus Immune Globulin is manufactured from human plasma Label. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
- Protein Based Therapies
Polyclonal antibody (pAb) - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>1AQK:H|PDBID|CHAIN|SEQUENCE EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYY ADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Download FASTA Format- Synonyms
- Human clostridium tetani immune globulin
- Human clostridium tetani toxoid immune globulin
- Tetanus immune globulin human
- Tetanus immune globulin,human
- Tetanus immunoglobulin
- Tetanus immunoglobulin (human)
Pharmacology
- Indication
For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status Label. May also be used in the treatment of active tetanus.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
- Contraindications & Blackbox Warnings
- Avoid life-threatening adverse drug eventsImprove clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events & improve clinical decision support.
- Pharmacodynamics
Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus Label.
- Mechanism of action
The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction 1. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
Target Actions Organism ATetanus toxin antibodyClostridium tetani (strain Massachusetts / E88) - Absorption
Tmax for intramuscular administration is 2 days Label.
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Half life is about 23 days Label.
- Clearance
Not Available
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted Label.
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Tetanus immune globulin, human. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Tetanus immune globulin, human. Aducanumab The risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Aducanumab. Alemtuzumab The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Tetanus immune globulin, human. Alirocumab The risk or severity of adverse effects can be increased when Alirocumab is combined with Tetanus immune globulin, human. Amivantamab The risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Amivantamab. Anifrolumab The risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Anifrolumab. Ansuvimab The risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Ansuvimab. Anthrax immune globulin human The risk or severity of adverse effects can be increased when Anthrax immune globulin human is combined with Tetanus immune globulin, human. Antilymphocyte immunoglobulin (horse) The risk or severity of adverse effects can be increased when Antilymphocyte immunoglobulin (horse) is combined with Tetanus immune globulin, human. Identify potential medication risksEasily compare up to 40 drugs with our drug interaction checker.Get severity rating, description, and management advice.Learn more - Food Interactions
- No interactions found.
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Hyper Tet Liquid 16.5 % Intramuscular Cutter Med & Biol, Division Of Miles Canada Ltd. 1959-12-31 1998-09-25 Canada HyperTET Solution 250 unit / mL Intramuscular Grifols Therapeutics Llc 2021-12-13 Not applicable Canada HyperTET Injection 250 [iU]/1mL Intramuscular GRIFOLS USA, LLC 1996-08-14 Not applicable US Hypertet S/d Solution 250 [iU] /mL Intramuscular Grifols Therapeutics Llc 1997-07-08 Not applicable Canada Hypertet S/d Solution 250 unit/1 Intramuscular Grifols Therapeutics Llc Not applicable Not applicable Canada
Categories
- ATC Codes
- J06BB02 — Tetanus immunoglobulin
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- V4SWI4RF4J
- CAS number
- Not Available
References
- General References
- Hassel B: Tetanus: pathophysiology, treatment, and the possibility of using botulinum toxin against tetanus-induced rigidity and spasms. Toxins (Basel). 2013 Jan 8;5(1):73-83. doi: 10.3390/toxins5010073. [Article]
- External Links
- FDA label
- Download (196 KB)
- MSDS
- Download (44.8 KB)
Clinical Trials
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Solution Intramuscular 250 IU Liquid Intramuscular 16.5 % Injection Intramuscular 250 [iU]/1mL Solution Intramuscular 250 unit / mL Solution Intramuscular 250 unit/1 Solution Intramuscular 250 [iU] /mL Injection Intramuscular 250 units Injection, solution Intramuscular; Parenteral 250 IU/1ML Injection, solution Intramuscular; Parenteral 500 IU/2ML Injection Intramuscular 250 iu/ml Injection Intramuscular 500 iu/2ml Injection, solution Injection Intramuscular 1500 IU/ML Injection Intramuscular 5000 IU/ML Injection, powder, for solution Injection Intramuscular Injection, solution Intramuscular Injection, solution Intramuscular; Parenteral 250 U.I./2ML Injection, solution Intramuscular; Parenteral 500 U.I. Powder, for solution Intravenous Solution Intramuscular 250 iu/1ml Solution Intramuscular 125 iu/1ml - Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Targets

- Kind
- Protein
- Organism
- Clostridium tetani (strain Massachusetts / E88)
- Pharmacological action
- Yes
- Actions
- Antibody
- General Function
- Zinc ion binding
- Specific Function
- Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can ...
- Gene Name
- tetX
- Uniprot ID
- P04958
- Uniprot Name
- Tetanus toxin
- Molecular Weight
- 150680.98 Da
Drug created at June 01, 2016 20:56 / Updated at June 27, 2022 14:55