Tetanus immune globulin

Identification

Summary

Tetanus immune globulin is a solution of antibodies used to prevent tetanus after an injury.

Brand Names
Hypertet
Generic Name
Tetanus immune globulin, human
Commonly known or available as Tetanus immune globulin
DrugBank Accession Number
DB11604
Background

Tetanus Immune Globulin is manufactured from human plasma Label. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Polyclonal antibody (pAb)
Protein Structure
Db11604
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>1AQK:H|PDBID|CHAIN|SEQUENCE
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYY
ADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Download FASTA Format
Synonyms
  • Human clostridium tetani immune globulin
  • Human clostridium tetani toxoid immune globulin
  • Tetanus immune globulin human
  • Tetanus immune globulin,human
  • Tetanus immunoglobulin

Pharmacology

Indication

For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization statu Label. May also be used in the treatment of active tetanus.

Pharmacology
Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:
Machine Learning
Data Science
Drug Discovery
Accelerate your drug discovery research with our fully connected ADMET dataset
Learn more
Associated Conditions
Contraindications & Blackbox Warnings
Contraindications
Contraindications & Blackbox Warnings
With our commercial data, access important information on dangerous risks, contraindications, and adverse effects.
Learn more
Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
Learn more
Pharmacodynamics

Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus Label.

Mechanism of action

The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction 1. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.

TargetActionsOrganism
ATetanus toxin
antibody
Clostridium tetani (strain Massachusetts / E88)
Absorption

Tmax for intramuscular administration is 2 days Label.

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Half life is about 23 days Label.

Clearance

Not Available

Adverse Effects
Medicalerrors
Reduce medical errors
and improve treatment outcomes with our comprehensive & structured data on drug adverse effects.
Learn more
Reduce medical errors & improve treatment outcomes with our adverse effects data
Learn more
Toxicity

No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted Label.

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tetanus immune globulin, human.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Tetanus immune globulin, human.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Tetanus immune globulin, human.
AlirocumabThe risk or severity of adverse effects can be increased when Alirocumab is combined with Tetanus immune globulin, human.
AnsuvimabThe risk or severity of adverse effects can be increased when Tetanus immune globulin, human is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Anthrax immune globulin human is combined with Tetanus immune globulin, human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Antilymphocyte immunoglobulin (horse) is combined with Tetanus immune globulin, human.
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Tetanus immune globulin, human.
Asfotase alfaThe risk or severity of adverse effects can be increased when Asfotase alfa is combined with Tetanus immune globulin, human.
AtezolizumabThe risk or severity of adverse effects can be increased when Atezolizumab is combined with Tetanus immune globulin, human.
Interactions
Improve patient outcomes
Build effective decision support tools with the industry’s most comprehensive drug-drug interaction checker.
Learn more
Food Interactions
Not Available

Products

Products
Comprehensive & structured drug product info
From application numbers to product codes, connect different identifiers through our commercial datasets.
Learn more
Easily connect various identifiers back to our datasets
Learn more
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
HyperTETInjection250 [iU]/1mLIntramuscularGRIFOLS USA, LLC1996-08-14Not applicableUS flag
Hypertet S/dSolutionIntramuscularGrifols Therapeutics LlcNot applicableNot applicableCanada flag
Hypertet S/dSolutionIntramuscularGrifols Therapeutics Llc1997-07-08Not applicableCanada flag

Categories

ATC Codes
J06BB02 — Tetanus immunoglobulin
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
V4SWI4RF4J
CAS number
Not Available

References

General References
  1. Hassel B: Tetanus: pathophysiology, treatment, and the possibility of using botulinum toxin against tetanus-induced rigidity and spasms. Toxins (Basel). 2013 Jan 8;5(1):73-83. doi: 10.3390/toxins5010073. [PubMed:23299659]
PubChem Substance
347911214
RxNav
91603
AHFS Codes
  • 80:04.00 — Serums
FDA label
Download (196 KB)
MSDS
Download (44.8 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4TerminatedPreventionTetanus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
SolutionIntramuscular
InjectionIntramuscular250 [iU]/1mL
Injection, solutionIntramuscular; Parenteral
Injection, solution
InjectionIntramuscular
Injection, powder, for solution
Injection, solutionIntramuscular
Powder, for solutionIntravenous
SolutionIntramuscular250 iu/1ml
SolutionIntramuscular125 iu/1ml
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Targets

Drugtargets
Accelerate your drug discovery research
with our fully connected ADMET & drug target dataset.
Learn more
Accelerate your drug discovery research with our ADMET & drug target dataset
Learn more
Kind
Protein
Organism
Clostridium tetani (strain Massachusetts / E88)
Pharmacological action
Yes
Actions
Antibody
General Function
Zinc ion binding
Specific Function
Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can ...
Gene Name
tetX
Uniprot ID
P04958
Uniprot Name
Tetanus toxin
Molecular Weight
150680.98 Da

Drug created on June 01, 2016 20:56 / Updated on May 06, 2021 06:19