Sulfotransferase 1C2

Details

Name
Sulfotransferase 1C2
Synonyms
  • 2.8.2.-
  • humSULTC2
  • ST1C2
  • Sulfotransferase 1C1
  • SULT1C#1
  • SULT1C1
Gene Name
SULT1C2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052134|Sulfotransferase 1C2
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVD
MIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFW
ENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGW
WEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTN
RSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Number of residues
296
Molecular Weight
34879.905
Theoretical pI
Not Available
GO Classification
Functions
sulfotransferase activity
Processes
3'-phosphoadenosine 5'-phosphosulfate metabolic process / amine metabolic process / sulfation
Components
cytoplasm / cytosol
General Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hydroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).
Specific Function
Sulfotransferase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0052135|Sulfotransferase 1C2 (SULT1C2)
ATGGCCCTGACCTCAGACCTGGGGAAACAGATAAAACTGAAAGAGGTGGAGGGGACCCTC
CTGCAGCCTGCAACTGTGGACAACTGGAGCCAGATCCAGAGCTTCGAGGCCAAACCAGAT
GATCTCCTCATCTGCACCTACCCTAAAGCAGGGACAACGTGGATTCAGGAAATTGTGGAT
ATGATTGAACAGAATGGGGACGTGGAGAAGTGCCAGCGAGCCATCATCCAACACCGCCAT
CCTTTCATTGAGTGGGCTCGGCCACCCCAACCTTCTGGTGTGGAAAAAGCCAAAGCAATG
CCCTCTCCACGGATACTAAAGACTCACCTTTCCACTCAGCTGCTGCCACCGTCTTTCTGG
GAAAACAACTGCAAGTTCCTTTATGTAGCTCGAAATGCCAAAGACTGTATGGTTTCCTAC
TACCATTTCCAAAGGATGAACCACATGCTTCCTGACCCTGGTACCTGGGAAGAGTATTTT
GAAACCTTCATCAATGGAAAAGTGGTTTGGGGTTCCTGGTTTGACCACGTGAAAGGATGG
TGGGAGATGAAAGACAGACACCAGATTCTCTTCCTCTTCTATGAGGACATAAAGAGGGAC
CCAAAGCATGAAATTCGGAAGGTGATGCAGTTCATGGGAAAGAAGGTGGATGAAACAGTG
CTAGATAAAATTGTCCAGGAGACGTCATTTGAGAAAATGAAAGAAAATCCCATGACAAAT
CGTTCTACAGTTTCCAAATCTATCTTGGACCAGTCAATTTCCTCCTTCATGAGAAAAGGA
ACTGTGGGGGATTGGAAAAACCACTTCACTGTTGCCCAGAATGAGAGGTTTGATGAAATC
TATAGAAGAAAGATGGAAGGAACCTCCATAAACTTCTGCATGGAACTCTGA
Chromosome Location
2
Locus
2q12.3
External Identifiers
ResourceLink
UniProtKB IDO00338
UniProtKB Entry NameST1C2_HUMAN
HGNC IDHGNC:11456
General References
  1. Her C, Kaur GP, Athwal RS, Weinshilboum RM: Human sulfotransferase SULT1C1: cDNA cloning, tissue-specific expression, and chromosomal localization. Genomics. 1997 May 1;41(3):467-70. doi: 10.1006/geno.1997.4683. [Article]
  2. Yoshinari K, Nagata K, Shimada M, Yamazoe Y: Molecular characterization of ST1C1-related human sulfotransferase. Carcinogenesis. 1998 May;19(5):951-3. doi: 10.1093/carcin/19.5.951. [Article]
  3. Sakakibara Y, Yanagisawa K, Katafuchi J, Ringer DP, Takami Y, Nakayama T, Suiko M, Liu MC: Molecular cloning, expression, and characterization of novel human SULT1C sulfotransferases that catalyze the sulfonation of N-hydroxy-2-acetylaminofluorene. J Biol Chem. 1998 Dec 18;273(51):33929-35. doi: 10.1074/jbc.273.51.33929. [Article]
  4. Hehonah N, Zhu X, Brix L, Bolton-Grob R, Barnett A, Windmill K, McManus M: Molecular cloning, expression, localisation and functional characterisation of a rabbit SULT1C2 sulfotransferase. Int J Biochem Cell Biol. 1999 Aug;31(8):869-82. doi: 10.1016/s1357-2725(99)00038-2. [Article]
  5. Freimuth RR, Raftogianis RB, Wood TC, Moon E, Kim UJ, Xu J, Siciliano MJ, Weinshilboum RM: Human sulfotransferases SULT1C1 and SULT1C2: cDNA characterization, gene cloning, and chromosomal localization. Genomics. 2000 Apr 15;65(2):157-65. doi: 10.1006/geno.2000.6150. [Article]
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  7. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  9. Dombrovski L, Dong A, Bochkarev A, Plotnikov AN: Crystal structures of human sulfotransferases SULT1B1 and SULT1C1 complexed with the cofactor product adenosine-3'- 5'-diphosphate (PAP). Proteins. 2006 Sep 1;64(4):1091-4. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09100Thyroid, porcineapprovedunknownsubstrateDetails
DB00871TerbutalineapprovedunknownsubstrateDetails
DB00960Pindololapproved, investigationalunknownsubstrateDetails
DB00968MethyldopaapprovednosubstrateDetails
DB12471Ibrexafungerpapproved, investigationalunknownsubstrateDetails