Integrin alpha-5

Details

Name
Integrin alpha-5
Synonyms
  • CD49 antigen-like family member E
  • Fibronectin receptor subunit alpha
  • FNRA
  • Integrin alpha-F
  • VLA-5
Gene Name
ITGA5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049691|Integrin alpha-5
MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA
Number of residues
1049
Molecular Weight
114535.52
Theoretical pI
Not Available
GO Classification
Functions
epidermal growth factor receptor binding / integrin binding / metal ion binding / platelet-derived growth factor receptor binding / vascular endothelial growth factor receptor 2 binding / virus receptor activity
Processes
angiogenesis / cell adhesion / cell adhesion mediated by integrin / cell-cell adhesion mediated by integrin / cell-substrate adhesion / cell-substrate junction assembly / endodermal cell differentiation / extracellular matrix organization / heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules / heterotypic cell-cell adhesion / integrin-mediated signaling pathway / leukocyte cell-cell adhesion / leukocyte migration / memory / negative regulation of anoikis / positive regulation of cell migration / positive regulation of cell-substrate adhesion / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of sprouting angiogenesis / positive regulation of vascular endothelial growth factor receptor signaling pathway / wound healing, spreading of epidermal cells
Components
alphav-beta3 integrin-vitronectin complex / cell surface / cytoplasmic vesicle / endoplasmic reticulum / external side of plasma membrane / focal adhesion / Golgi apparatus / integrin complex / plasma membrane / ruffle / synapse
General Function
Integrin alpha-5/beta-1 is a receptor for fibronectin and fibrinogen. It recognizes the sequence R-G-D in its ligands. ITGA5:ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGA5:ITGB1 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887, PubMed:17158881).
Specific Function
Epidermal growth factor receptor binding
Pfam Domain Function
Transmembrane Regions
996-1021
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0049692|Integrin alpha-5 (ITGA5)
ATGGGGAGCCGGACGCCAGAGTCCCCTCTCCACGCCGTGCAGCTGCGCTGGGGCCCCCGG
CGCCGACCCCCGCTGCTGCCGCTGCTGTTGCTGCTGCTGCCGCCGCCACCCAGGGTCGGG
GGCTTCAACTTAGACGCGGAGGCCCCAGCAGTACTCTCGGGGCCCCCGGGCTCCTTCTTC
GGATTCTCAGTGGAGTTTTACCGGCCGGGAACAGACGGGGTCAGTGTGCTGGTGGGAGCA
CCCAAGGCTAATACCAGCCAGCCAGGAGTGCTGCAGGGTGGTGCTGTCTACCTCTGTCCT
TGGGGTGCCAGCCCCACACAGTGCACCCCCATTGAATTTGACAGCAAAGGCTCTCGGCTC
CTGGAGTCCTCACTGTCCAGCTCAGAGGGAGAGGAGCCTGTGGAGTACAAGTCCTTGCAG
TGGTTCGGGGCAACAGTTCGAGCCCATGGCTCCTCCATCTTGGCATGCGCTCCACTGTAC
AGCTGGCGCACAGAGAAGGAGCCACTGAGCGACCCCGTGGGCACCTGCTACCTCTCCACA
GATAACTTCACCCGAATTCTGGAGTATGCACCCTGCCGCTCAGATTTCAGCTGGGCAGCA
GGACAGGGTTACTGCCAAGGAGGCTTCAGTGCCGAGTTCACCAAGACTGGCCGTGTGGTT
TTAGGTGGACCAGGAAGCTATTTCTGGCAAGGCCAGATCCTGTCTGCCACTCAGGAGCAG
ATTGCAGAATCTTATTACCCCGAGTACCTGATCAACCTGGTTCAGGGGCAGCTGCAGACT
CGCCAGGCCAGTTCCATCTATGATGACAGCTACCTAGGATACTCTGTGGCTGTTGGTGAA
TTCAGTGGTGATGACACAGAAGACTTTGTTGCTGGTGTGCCCAAAGGGAACCTCACTTAC
GGCTATGTCACCATCCTTAATGGCTCAGACATTCGATCCCTCTACAACTTCTCAGGGGAA
CAGATGGCCTCCTACTTTGGCTATGCAGTGGCCGCCACAGACGTCAATGGGGACGGGCTG
GATGACTTGCTGGTGGGGGCACCCCTGCTCATGGATCGGACCCCTGACGGGCGGCCTCAG
GAGGTGGGCAGGGTCTACGTCTACCTGCAGCACCCAGCCGGCATAGAGCCCACGCCCACC
CTTACCCTCACTGGCCATGATGAGTTTGGCCGATTTGGCAGCTCCTTGACCCCCCTGGGG
GACCTGGACCAGGATGGCTACAATGATGTGGCCATCGGGGCTCCCTTTGGTGGGGAGACC
CAGCAGGGAGTAGTGTTTGTATTTCCTGGGGGCCCAGGAGGGCTGGGCTCTAAGCCTTCC
CAGGTTCTGCAGCCCCTGTGGGCAGCCAGCCACACCCCAGACTTCTTTGGCTCTGCCCTT
CGAGGAGGCCGAGACCTGGATGGCAATGGATATCCTGATCTGATTGTGGGGTCCTTTGGT
GTGGACAAGGCTGTGGTATACAGGGGCCGCCCCATCGTGTCCGCTAGTGCCTCCCTCACC
ATCTTCCCCGCCATGTTCAACCCAGAGGAGCGGAGCTGCAGCTTAGAGGGGAACCCTGTG
GCCTGCATCAACCTTAGCTTCTGCCTCAATGCTTCTGGAAAACACGTTGCTGACTCCATT
GGTTTCACAGTGGAACTTCAGCTGGACTGGCAGAAGCAGAAGGGAGGGGTACGGCGGGCA
CTGTTCCTGGCCTCCAGGCAGGCAACCCTGACCCAGACCCTGCTCATCCAGAATGGGGCT
CGAGAGGATTGCAGAGAGATGAAGATCTACCTCAGGAACGAGTCAGAATTTCGAGACAAA
CTCTCGCCGATTCACATCGCTCTCAACTTCTCCTTGGACCCCCAAGCCCCAGTGGACAGC
CACGGCCTCAGGCCAGCCCTACATTATCAGAGCAAGAGCCGGATAGAGGACAAGGCTCAG
ATCTTGCTGGACTGTGGAGAAGACAACATCTGTGTGCCTGACCTGCAGCTGGAAGTGTTT
GGGGAGCAGAACCATGTGTACCTGGGTGACAAGAATGCCCTGAACCTCACTTTCCATGCC
CAGAATGTGGGTGAGGGTGGCGCCTATGAGGCTGAGCTTCGGGTCACCGCCCCTCCAGAG
GCTGAGTACTCAGGACTCGTCAGACACCCAGGGAACTTCTCCAGCCTGAGCTGTGACTAC
TTTGCCGTGAACCAGAGCCGCCTGCTGGTGTGTGACCTGGGCAACCCCATGAAGGCAGGA
GCCAGTCTGTGGGGTGGCCTTCGGTTTACAGTCCCTCATCTCCGGGACACTAAGAAAACC
ATCCAGTTTGACTTCCAGATCCTCAGCAAGAATCTCAACAACTCGCAAAGCGACGTGGTT
TCCTTTCGGCTCTCCGTGGAGGCTCAGGCCCAGGTCACCCTGAACGGTGTCTCCAAGCCT
GAGGCAGTGCTATTCCCAGTAAGCGACTGGCATCCCCGAGACCAGCCTCAGAAGGAGGAG
GACCTGGGACCTGCTGTCCACCATGTCTATGAGCTCATCAACCAAGGCCCCAGCTCCATT
AGCCAGGGTGTGCTGGAACTCAGCTGTCCCCAGGCTCTGGAAGGTCAGCAGCTCCTATAT
GTGACCAGAGTTACGGGACTCAACTGCACCACCAATCACCCCATTAACCCAAAGGGCCTG
GAGTTGGATCCCGAGGGTTCCCTGCACCACCAGCAAAAACGGGAAGCTCCAAGCCGCAGC
TCTGCTTCCTCGGGACCTCAGATCCTGAAATGCCCGGAGGCTGAGTGTTTCAGGCTGCGC
TGTGAGCTCGGGCCCCTGCACCAACAAGAGAGCCAAAGTCTGCAGTTGCATTTCCGAGTC
TGGGCCAAGACTTTCTTGCAGCGGGAGCACCAGCCATTTAGCCTGCAGTGTGAGGCTGTG
TACAAAGCCCTGAAGATGCCCTACCGAATCCTGCCTCGGCAGCTGCCCCAAAAAGAGCGT
CAGGTGGCCACAGCTGTGCAATGGACCAAGGCAGAAGGCAGCTATGGCGTCCCACTGTGG
ATCATCATCCTAGCCATCCTGTTTGGCCTCCTGCTCCTAGGTCTACTCATCTACATCCTC
TACAAGCTTGGATTCTTCAAACGCTCCCTCCCATATGGCACCGCCATGGAAAAAGCTCAG
CTCAAGCCTCCAGCCACCTCTGATGCCTGA
Chromosome Location
12
Locus
12q13.13
External Identifiers
ResourceLink
UniProtKB IDP08648
UniProtKB Entry NameITA5_HUMAN
HGNC IDHGNC:6141
General References
  1. Argraves WS, Suzuki S, Arai H, Thompson K, Pierschbacher MD, Ruoslahti E: Amino acid sequence of the human fibronectin receptor. J Cell Biol. 1987 Sep;105(3):1183-90. [Article]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  3. Birkenmeier TM, McQuillan JJ, Boedeker ED, Argraves WS, Ruoslahti E, Dean DC: The alpha 5 beta 1 fibronectin receptor. Characterization of the alpha 5 gene promoter. J Biol Chem. 1991 Oct 25;266(30):20544-9. [Article]
  4. Fitzgerald LA, Poncz M, Steiner B, Rall SC Jr, Bennett JS, Phillips DR: Comparison of cDNA-derived protein sequences of the human fibronectin and vitronectin receptor alpha-subunits and platelet glycoprotein IIb. Biochemistry. 1987 Dec 15;26(25):8158-65. [Article]
  5. Argraves WS, Pytela R, Suzuki S, Millan JL, Pierschbacher MD, Ruoslahti E: cDNA sequences from the alpha subunit of the fibronectin receptor predict a transmembrane domain and a short cytoplasmic peptide. J Biol Chem. 1986 Oct 5;261(28):12922-4. [Article]
  6. Takada Y, Strominger JL, Hemler ME: The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis. Proc Natl Acad Sci U S A. 1987 May;84(10):3239-43. [Article]
  7. Barillari G, Sgadari C, Fiorelli V, Samaniego F, Colombini S, Manzari V, Modesti A, Nair BC, Cafaro A, Sturzl M, Ensoli B: The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor. Blood. 1999 Jul 15;94(2):663-72. [Article]
  8. Sano H, Liu SC, Lane WS, Piletz JE, Lienhard GE: Insulin receptor substrate 4 associates with the protein IRAS. J Biol Chem. 2002 May 31;277(22):19439-47. Epub 2002 Mar 23. [Article]
  9. Krokhin OV, Cheng K, Sousa SL, Ens W, Standing KG, Wilkins JA: Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains. Biochemistry. 2003 Nov 11;42(44):12950-9. [Article]
  10. Weigel-Kelley KA, Yoder MC, Srivastava A: Alpha5beta1 integrin as a cellular coreceptor for human parvovirus B19: requirement of functional activation of beta1 integrin for viral entry. Blood. 2003 Dec 1;102(12):3927-33. Epub 2003 Aug 7. [Article]
  11. Lin CG, Leu SJ, Chen N, Tebeau CM, Lin SX, Yeung CY, Lau LF: CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family. J Biol Chem. 2003 Jun 27;278(26):24200-8. Epub 2003 Apr 13. [Article]
  12. Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM: Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins. J Biol Chem. 2003 Sep 5;278(36):34605-16. Epub 2003 Jun 13. [Article]
  13. Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J: Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins. J Biol Chem. 2005 Sep 23;280(38):32655-61. Epub 2005 Jul 28. [Article]
  14. Pellinen T, Arjonen A, Vuoriluoto K, Kallio K, Fransen JA, Ivaska J: Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins. J Cell Biol. 2006 Jun 5;173(5):767-80. [Article]
  15. Jovanovic J, Takagi J, Choulier L, Abrescia NG, Stuart DI, van der Merwe PA, Mardon HJ, Handford PA: alphaVbeta6 is a novel receptor for human fibrillin-1. Comparative studies of molecular determinants underlying integrin-rgd affinity and specificity. J Biol Chem. 2007 Mar 2;282(9):6743-51. Epub 2006 Dec 11. [Article]
  16. Saegusa J, Akakura N, Wu CY, Hoogland C, Ma Z, Lam KS, Liu FT, Takada YK, Takada Y: Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner. J Biol Chem. 2008 Sep 19;283(38):26107-15. doi: 10.1074/jbc.M804835200. Epub 2008 Jul 17. [Article]
  17. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
  18. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [Article]
  19. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  20. Paule S, Aljofan M, Simon C, Rombauts LJ, Nie G: Cleavage of endometrial alpha-integrins into their functional forms is mediated by proprotein convertase 5/6. Hum Reprod. 2012 Sep;27(9):2766-74. doi: 10.1093/humrep/des203. Epub 2012 Jun 26. [Article]
  21. Freeman TC Jr, Black JL, Bray HG, Dagliyan O, Wu YI, Tripathy A, Dokholyan NV, Leisner TM, Parise LV: Identification of novel integrin binding partners for calcium and integrin binding protein 1 (CIB1): structural and thermodynamic basis of CIB1 promiscuity. Biochemistry. 2013 Oct 8;52(40):7082-90. doi: 10.1021/bi400678y. Epub 2013 Sep 25. [Article]
  22. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [Article]
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  24. Wei Y, Zhang Y, Cai H, Mirza AM, Iorio RM, Peeples ME, Niewiesk S, Li J: Roles of the putative integrin-binding motif of the human metapneumovirus fusion (f) protein in cell-cell fusion, viral infectivity, and pathogenesis. J Virol. 2014 Apr;88(8):4338-52. doi: 10.1128/JVI.03491-13. Epub 2014 Jan 29. [Article]
  25. Fujita M, Zhu K, Fujita CK, Zhao M, Lam KS, Kurth MJ, Takada YK, Takada Y: Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins alphavbeta3, alpha4beta1, and alpha5beta1. J Biol Chem. 2015 Jan 2;290(1):259-71. doi: 10.1074/jbc.M114.579946. Epub 2014 Nov 14. [Article]
  26. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
  27. Nagae M, Re S, Mihara E, Nogi T, Sugita Y, Takagi J: Crystal structure of alpha5beta1 integrin ectodomain: atomic details of the fibronectin receptor. J Cell Biol. 2012 Apr 2;197(1):131-40. doi: 10.1083/jcb.201111077. Epub 2012 Mar 26. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02709ResveratrolinvestigationalunknownDetails