30S ribosomal protein S14 type Z
Details
- Name
- 30S ribosomal protein S14 type Z
- Synonyms
- rpsN
- Gene Name
- rpsZ
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- Amino acid sequence
>lcl|BSEQ0051261|30S ribosomal protein S14 type Z MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS W
- Number of residues
- 61
- Molecular Weight
- 7139.57
- Theoretical pI
- Not Available
- GO Classification
- Functionsmetal ion binding / rRNA binding / structural constituent of ribosomeProcessestranslationComponentsribosome
- General Function
- Required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site (By similarity). Binds 16S rRNA in center of the 30S subunit head.
- Specific Function
- Metal ion binding
- Pfam Domain Function
- Ribosomal_S14 (PF00253)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0DOY6 UniProtKB Entry Name RS14Z_THET8 - General References
- Tsiboli P, Choli T: Studies on S14 protein from Thermus thermophilus possessing zinc finger-like motifs. Biol Chem Hoppe Seyler. 1995 Feb;376(2):127-30. [Article]
- Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
- Tsiboli P, Triantafillidou D, Franceschi F, Choli-Papadopoulou T: Studies on the Zn-containing S14 ribosomal protein from Thermus thermophilus. Eur J Biochem. 1998 Aug 15;256(1):136-41. [Article]
- Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
- Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
- Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
- Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
- Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
- Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
- Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
- Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
- Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]
- Petry S, Brodersen DE, Murphy FV 4th, Dunham CM, Selmer M, Tarry MJ, Kelley AC, Ramakrishnan V: Crystal structures of the ribosome in complex with release factors RF1 and RF2 bound to a cognate stop codon. Cell. 2005 Dec 29;123(7):1255-66. [Article]
- Weixlbaumer A, Jin H, Neubauer C, Voorhees RM, Petry S, Kelley AC, Ramakrishnan V: Insights into translational termination from the structure of RF2 bound to the ribosome. Science. 2008 Nov 7;322(5903):953-6. doi: 10.1126/science.1164840. [Article]
- Jin H, Kelley AC, Loakes D, Ramakrishnan V: Structure of the 70S ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release. Proc Natl Acad Sci U S A. 2010 May 11;107(19):8593-8. doi: 10.1073/pnas.1003995107. Epub 2010 Apr 26. [Article]