High affinity immunoglobulin gamma Fc receptor I

Details

Name
High affinity immunoglobulin gamma Fc receptor I
Synonyms
  • Fc-gamma RI
  • Fc-gamma RIA
  • FCG1
  • FcgammaRIa
  • FCGR1
  • FcRI
  • IGFR1
  • IgG Fc receptor I
Gene Name
FCGR1A
UniProtKB Entry
P12314Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0001416|High affinity immunoglobulin gamma Fc receptor I
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT
Number of residues
374
Molecular Weight
42631.525
Theoretical pI
8.08
GO Classification
Functions
high-affinity IgG receptor activity / IgG binding / IgG receptor activity
Processes
antibody-dependent cellular cytotoxicity / cell surface receptor signaling pathway / defense response to bacterium / Fc-gamma receptor signaling pathway / phagocytosis, recognition / positive regulation of phagocytosis / positive regulation of type IIa hypersensitivity / positive regulation of type III hypersensitivity / receptor-mediated endocytosis
Components
external side of plasma membrane
General Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses. Mediates IgG effector functions on monocytes triggering antibody-dependent cellular cytotoxicity (ADCC) of virus-infected cells
Specific Function
High-affinity igg receptor activity
Pfam Domain Function
Signal Regions
1-15
Transmembrane Regions
293-313
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016183|High affinity immunoglobulin gamma Fc receptor I (FCGR1A)
ATGTGGTTCTTGACAACTCTGCTCCTTTGGGTTCCAGTTGATGGGCAAGTGGACACCACA
AAGGCAGTGATCACTTTGCAGCCTCCATGGGTCAGCGTGTTCCAAGAGGAAACCGTAACC
TTGCACTGTGAGGTGCTCCATCTGCCTGGGAGCAGCTCTACACAGTGGTTTCTCAATGGC
ACAGCCACTCAGACCTCGACCCCCAGCTACAGAATCACCTCTGCCAGTGTCAATGACAGT
GGTGAATACAGGTGCCAGAGAGGTCTCTCAGGGCGAAGTGACCCCATACAGCTGGAAATC
CACAGAGGCTGGCTACTACTGCAGGTCTCCAGCAGAGTCTTCACGGAAGGAGAACCTCTG
GCCTTGAGGTGTCATGCGTGGAAGGATAAGCTGGTGTACAATGTGCTTTACTATCGAAAT
GGCAAAGCCTTTAAGTTTTTCCACTGGAATTCTAACCTCACCATTCTGAAAACCAACATA
AGTCACAATGGCACCTACCATTGCTCAGGCATGGGAAAGCATCGCTACACATCAGCAGGA
ATATCTGTCACTGTGAAAGAGCTATTTCCAGCTCCAGTGCTGAATGCATCTGTGACATCC
CCACTCCTGGAGGGGAATCTGGTCACCCTGAGCTGTGAAACAAAGTTGCTCTTGCAGAGG
CCTGGTTTGCAGCTTTACTTCTCCTTCTACATGGGCAGCAAGACCCTGCGAGGCAGGAAC
ACATCCTCTGAATACCAAATACTAACTGCTAGAAGAGAAGACTCTGGGTTATACTGGTGC
GAGGCTGCCACAGAGGATGGAAATGTCCTTAAGCGCAGCCCTGAGTTGGAGCTTCAAGTG
CTTGGCCTCCAGTTACCAACTCCTGTCTGGTTTCATGTCCTTTTCTATCTGGCAGTGGGA
ATAATGTTTTTAGTGAACACTGTTCTCTGGGTGACAATACGTAAAGAACTGAAAAGAAAG
AAAAAGTGGGATTTAGAAATCTCTTTGGATTCTGGTCATGAGAAGAAGGTAATTTCCAGC
CTTCAAGAAGACAGACATTTAGAAGAAGAGCTGAAATGTCAGGAACAAAAAGAAGAACAG
CTGCAGGAAGGGGTGCACCGGAAGGAGCCCCAGGGGGCCACGTAG
Chromosome Location
1
Locus
1q21.2
External Identifiers
ResourceLink
UniProtKB IDP12314
UniProtKB Entry NameFCGR1_HUMAN
GenBank Protein ID31332
GenBank Gene IDX14356
GeneCard IDFCGR1A
GenAtlas IDFCGR1A
HGNC IDHGNC:3613
PDB ID(s)3RJD, 4W4O, 4X4M, 4ZNE, 8DIN, 8DIR, 8DJ7
KEGG IDhsa:2209
NCBI Gene ID2209
General References
  1. Allen JM, Seed B: Nucleotide sequence of three cDNAs for the human high affinity Fc receptor (FcRI). Nucleic Acids Res. 1988 Dec 23;16(24):11824. [Article]
  2. Allen JM, Seed B: Isolation and expression of functional high-affinity Fc receptor complementary DNAs. Science. 1989 Jan 20;243(4889):378-81. [Article]
  3. Porges AJ, Redecha PB, Doebele R, Pan LC, Salmon JE, Kimberly RP: Novel Fc gamma receptor I family gene products in human mononuclear cells. J Clin Invest. 1992 Nov;90(5):2102-9. [Article]
  4. Benech PD, Sastry K, Iyer RR, Eichbaum QG, Raveh DP, Ezekowitz RA: Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure. J Exp Med. 1992 Oct 1;176(4):1115-23. [Article]
  5. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
  6. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [Article]
  7. Ernst LK, van de Winkel JG, Chiu IM, Anderson CL: Three genes for the human high affinity Fc receptor for IgG (Fc gamma RI) encode four distinct transcription products. J Biol Chem. 1992 Aug 5;267(22):15692-700. [Article]
  8. Wang AV, Scholl PR, Geha RS: Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn. J Exp Med. 1994 Sep 1;180(3):1165-70. [Article]
  9. van Vugt MJ, Heijnen AF, Capel PJ, Park SY, Ra C, Saito T, Verbeek JS, van de Winkel JG: FcR gamma-chain is essential for both surface expression and function of human Fc gamma RI (CD64) in vivo. Blood. 1996 May 1;87(9):3593-9. [Article]
  10. Ernst LK, Duchemin AM, Miller KL, Anderson CL: Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts. Mol Immunol. 1998 Oct;35(14-15):943-54. [Article]
  11. van Vugt MJ, Kleijmeer MJ, Keler T, Zeelenberg I, van Dijk MA, Leusen JH, Geuze HJ, van de Winkel JG: The FcgammaRIa (CD64) ligand binding chain triggers major histocompatibility complex class II antigen presentation independently of its associated FcR gamma-chain. Blood. 1999 Jul 15;94(2):808-17. [Article]
  12. Edberg JC, Yee AM, Rakshit DS, Chang DJ, Gokhale JA, Indik ZK, Schreiber AD, Kimberly RP: The cytoplasmic domain of human FcgammaRIa alters the functional properties of the FcgammaRI.gamma-chain receptor complex. J Biol Chem. 1999 Oct 15;274(42):30328-33. [Article]
  13. Tridandapani S, Lyden TW, Smith JL, Carter JE, Coggeshall KM, Anderson CL: The adapter protein LAT enhances fcgamma receptor-mediated signal transduction in myeloid cells. J Biol Chem. 2000 Jul 7;275(27):20480-7. [Article]
  14. Kim MK, Huang ZY, Hwang PH, Jones BA, Sato N, Hunter S, Kim-Han TH, Worth RG, Indik ZK, Schreiber AD: Fcgamma receptor transmembrane domains: role in cell surface expression, gamma chain interaction, and phagocytosis. Blood. 2003 Jun 1;101(11):4479-84. [Article]
  15. Beekman JM, Bakema JE, van de Winkel JG, Leusen JH: Direct interaction between FcgammaRI (CD64) and periplakin controls receptor endocytosis and ligand binding capacity. Proc Natl Acad Sci U S A. 2004 Jul 13;101(28):10392-7. Epub 2004 Jun 30. [Article]
  16. Beekman JM, van der Poel CE, van der Linden JA, van den Berg DL, van den Berghe PV, van de Winkel JG, Leusen JH: Filamin A stabilizes Fc gamma RI surface expression and prevents its lysosomal routing. J Immunol. 2008 Mar 15;180(6):3938-45. [Article]
  17. Beekman JM, Bakema JE, van der Poel CE, van der Linden JA, van de Winkel JG, Leusen JH: Protein 4.1G binds to a unique motif within the Fc gamma RI cytoplasmic tail. Mol Immunol. 2008 Apr;45(7):2069-75. Epub 2007 Nov 26. [Article]
  18. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
  19. Lu J, Ellsworth JL, Hamacher N, Oak SW, Sun PD: Crystal structure of Fcgamma receptor I and its implication in high affinity gamma-immunoglobulin binding. J Biol Chem. 2011 Nov 25;286(47):40608-13. doi: 10.1074/jbc.M111.257550. Epub 2011 Sep 29. [Article]

Associated Data

Bio-Entities
Bio-EntityType
High affinity immunoglobulin gamma Fc receptor I (Humans)protein
primary
Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Porfimer sodiumapproved, investigationalunknowntargetantagonistDetails
CetuximabapprovedunknowntargetbinderDetails
Etanerceptapproved, investigationalunknowntargetligandDetails
Human immunoglobulin Gapproved, investigationalyestargetantagonistDetails
Gemtuzumab ozogamicinapproved, investigationalunknowntargetDetails
Alemtuzumabapproved, investigationalunknowntargetbinderDetails
Natalizumabapproved, investigationalunknowntargetligandDetails
Palivizumabapproved, investigationalunknowntargetDetails
Daclizumabinvestigational, withdrawnunknowntargetDetails
Sarilumabapproved, investigationalunknowntargetunknownDetails
Catumaxomabapproved, investigational, withdrawnyestargetagonistDetails
AtomoxetineapprovednocarrierbinderDetails
Trastuzumab deruxtecanapproved, investigationalyestargetantibodyDetails
Bevacizumabapproved, investigationalunknowntargetDetails