Daclizumab

Identification

Summary

Daclizumab is a monoclonal anti-CD25 antibody that blocks the interleukin-2 receptor which is used to treat relapsing forms of multiple sclerosis.

Generic Name

Daclizumab

DrugBank Accession Number

DB00111

Background

Humanized IgG1 Mab that binds to the human interleukin-2 receptor (anti-Tac or anti-CD25). Daclizumab is a composite of human (90%) and murine (10%) antibody sequences. The human sequences were derived from the constant domains of human IgG1 and the variable framework regions of the Eu myeloma antibody. The murine sequences were derived from the complementarity-determining regions of a murine anti-Tac antibody.

On 22 April 2008, Roche Registration Limited chose to voluntarily withdraw the marketing authorization for their product Zenapax (daclizumab), as indicated for the prophylaxis of acute organ rejection in de novo allogeneic renal transplantation and used concomitantly with an immunosuppressive regimen like cyclosporine and corticosteroids in patients who are not hight immunized, for commercial reasons and confirmed that this decision was not related to any safety concerns associated with the use of Zenapax (daclizumab) ². Regardless of the withdrawal of Zenapax, Biogen and Abbvie's Zinbryta (daclizumab), as indicated for the treatment of adult patients with relapsing forms of multiple sclerosis, was approved for use by the FDA in 2016 ³.

Despite being approved for use, Zinbryta (daclizumab)'s complex pre-existing safety profile consisting of its restricted availability through a Risk Evaluation and Mitigation Strategy program ¹ and its black box warning for possible hepatic injury, autoimmune hepatitis, and other immune mediated disorders ¹ meant its therapeutic usage, adverse effects, and prescribing information was subject to continuous monitoring and updating.

Although Zinbryta (daclizumab) was available for patients as needed until 30 April 2018, Biogen and Abbvie announced a voluntary withdrawal of their product Zinbryta (daclizumab) from the global market on 2 March 2018 ¹. This withdrawal was concurrent to the European Medicines Agency announcement of a recall owing to 12 worldwide reports of serious inflammatory brain disorders associated with the use of Zinbryta (daclizumab) ¹.

Type

Biotech

Groups

Investigational, Withdrawn

Biologic Classification

Protein Based Therapies
Monoclonal antibody (mAb)

Protein Structure

Protein Chemical Formula: C₆₃₃₂H₉₈₀₈N₁₆₇₈O₁₉₈₉S₄₂
Protein Average Weight: 142612.1 Da

Sequences

>Humanized Anti-CD25 Heavy Chain 1
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYRMHWVRQAPGQGLEWIGYINPSTGYTEY
NQKFKDKATITADESTNTAYMELSSLRSEDTAVYYCARGGGVFDYWGQGTTLTVSSGPSV
FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV
VTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV
LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC
SVMHEALHNHYTQKSLSLSPGK

>Humanized Anti-CD25 Light Chain 1
DIQMTQSPSTLSASVGDRVTITCSASSSISYMHWYQQKPGKAPKLLIYTTSNLASGVPAR
FSGSGSGTEFTLTISSLQPDDFATYYCHQRSTYPLTFGSGTKVEVKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNR

Download FASTA Format

Synonyms

Dacliximab
Daclizumab
Daclizumab beta

External IDs

RO 24-7375
RO-24-7375

Pharmacology

Indication

Zenapax is a humanized monoclonal antibody used for prevention of renal transplant rejection

Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:

Machine Learning

Data Science

Drug Discovery

Accelerate your drug discovery research with our fully connected ADMET dataset

Learn more

Associated Conditions

Relapsing Multiple Sclerosis (RMS)

Contraindications & Blackbox Warnings

With our commercial data, access important information on dangerous risks, contraindications, and adverse effects.

Learn more

Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects

Learn more

Pharmacodynamics

Zenapax functions as an IL-2 receptor antagonist. Specifically it inhibits IL-2-mediated activation of lymphocytes, a critical pathway in the cellular immune response involved in allograft rejection.

Mechanism of action

Zenepax binds with high-affinity to the Tac subunit of the high-affinity IL-2 receptor complex and inhibits IL-2 binding. The IL-2 receptor (Tac) subunit is expressed on activated but not resting lymphocytes.

Target	Actions	Organism
AInterleukin-2 receptor subunit alpha	antibody	Humans
AInterleukin-2 receptor subunit beta	antibody	Humans
ULow affinity immunoglobulin gamma Fc region receptor III-B	Not Available	Humans
UComplement C1r subcomponent	Not Available	Humans
UComplement C1q subcomponent subunit A	Not Available	Humans
UComplement C1q subcomponent subunit B	Not Available	Humans
UComplement C1q subcomponent subunit C	Not Available	Humans
ULow affinity immunoglobulin gamma Fc region receptor III-A	Not Available	Humans
UHigh affinity immunoglobulin gamma Fc receptor I	Not Available	Humans
ULow affinity immunoglobulin gamma Fc region receptor II-a	Not Available	Humans
ULow affinity immunoglobulin gamma Fc region receptor II-b	Not Available	Humans
ULow affinity immunoglobulin gamma Fc region receptor II-c	Not Available	Humans

Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to lymphocytes.

Route of elimination

Not Available

Half-life

11-38 days

Clearance

Not Available

Adverse Effects

Reduce medical errors

and improve treatment outcomes with our comprehensive & structured data on drug adverse effects.

Learn more

Reduce medical errors & improve treatment outcomes with our adverse effects data

Learn more

Toxicity

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Drug	Interaction
Integrate drug-drug interactions in your software
Abatacept	The risk or severity of adverse effects can be increased when Daclizumab is combined with Abatacept.
Abciximab	The risk or severity of adverse effects can be increased when Abciximab is combined with Daclizumab.
Adalimumab	The risk or severity of adverse effects can be increased when Adalimumab is combined with Daclizumab.
Adenovirus type 7 vaccine live	The risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Daclizumab.
Aducanumab	The risk or severity of adverse effects can be increased when Daclizumab is combined with Aducanumab.
Aldesleukin	The risk or severity of adverse effects can be increased when Aldesleukin is combined with Daclizumab.
Alefacept	The risk or severity of adverse effects can be increased when Alefacept is combined with Daclizumab.
Alemtuzumab	The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Daclizumab.
Alirocumab	The risk or severity of adverse effects can be increased when Daclizumab is combined with Alirocumab.
Altretamine	The risk or severity of adverse effects can be increased when Daclizumab is combined with Altretamine.

Improve patient outcomes

Build effective decision support tools with the industry’s most comprehensive drug-drug interaction checker.

Learn more

Food Interactions

Not Available

Products

Comprehensive & structured drug product info

From application numbers to product codes, connect different identifiers through our commercial datasets.

Learn more

Easily connect various identifiers back to our datasets

Learn more

Brand Name Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Zenapax	Injection, solution, concentrate	25 mg	Intravenous	Roche Registration Limited	2016-09-08	2009-02-13
Zenapax	Injection, solution, concentrate	25 mg	Intravenous	Roche Registration Limited	2016-09-08	2009-02-13
Zenapax	Injection, solution, concentrate	25 mg/5mL	Intravenous	Genentech, Inc.	1997-12-10	2011-09-30
Zenapax 5mg/ml	Liquid	5 mg / mL	Intravenous	Hoffmann La Roche	2000-03-02	2011-10-17
Zinbryta	Injection, solution	150 mg/1mL	Subcutaneous	Abbvie	2016-05-27	2019-10-31
Zinbryta	Solution	150 mg / mL	Subcutaneous	Biogen	Not applicable	Not applicable
Zinbryta	Solution	150 mg / mL	Subcutaneous	Biogen	2017-03-30	2018-04-30
Zinbryta Pen	Injection, solution	150 mg/1mL	Subcutaneous	Abbvie	2017-05-26	2019-10-31

Chemical Identifiers

UNII: CUJ2MVI71Y
CAS number: 152923-56-3

References

General References

U.S. Food & Drug Administration: FDA working with manufacturers to withdraw Zinbryta from the market in the United States [Link]
European Medicines Agency: Public state on Zenapax (daclizumab), Withdrawal of the marketing authorization in the European Union [Link]
U.S. FDA Zinbryta (daclizumab) Prescribing Information [Link]

External Links

UniProt: P01857
Genbank: J00228
KEGG Drug: D03639
PubChem Substance: 46504469
RxNav: 190353
ChEMBL: CHEMBL1201605
Therapeutic Targets Database: DAP000389
PharmGKB: PA164764446
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Daclizumab

FDA label

Download (666 KB)

MSDS

Download (788 KB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
4	Completed	Not Available	End Stage Renal Disease (ESRD) / Living Donors	1
4	Completed	Not Available	Kidney Transplantation	1
4	Completed	Prevention	Acute Allograft Rejection in Simultaneous Kidney/Pancreas Transplant Recipients	1
4	Completed	Prevention	Kidney Failure, Kidney Transplant	1
4	Completed	Prevention	Renal Transplant Recipient Patients	1
4	Completed	Treatment	End-stage Liver Disease (ESLD) / Hepatitis C Viral Infection	1
4	Completed	Treatment	Graft Versus Host Disease (GVHD)	1
4	Completed	Treatment	Heart Transplantation	2
4	Completed	Treatment	HTLV-I Associated Adult T-cell Leukaemia/Lymphoma (ATLL)	1
4	Completed	Treatment	Kidney Transplantation	2

Pharmacoeconomics

Manufacturers

Not Available

Packagers

F Hoffmann La Roche Ltd.
F Hoffmann-La Roche Ltd.

Dosage Forms

Form	Route	Strength
Injection, solution, concentrate	Intravenous
Injection, solution, concentrate	Intravenous	25 mg/5mL
Injection, solution, concentrate	Intravenous	25 mg
Liquid	Intravenous	5 mg / mL
Injection, solution	Subcutaneous
Solution	Subcutaneous	150 mg / mL
Injection, solution	Subcutaneous	150 mg/1mL

Prices

Not Available

Patents

Not Available

Properties

State

Liquid

Experimental Properties

Property	Value	Source
melting point (°C)	61 °C (FAB fragment), 71 °C (whole mAb)	Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity	-0.437	Not Available
isoelectric point	8.46	Not Available

Targets

Accelerate your drug discovery research

with our fully connected ADMET & drug target dataset.

Learn more

Accelerate your drug discovery research with our ADMET & drug target dataset

Learn more

Details1. Interleukin-2 receptor subunit alpha

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Antibody

General Function: Interleukin-2 receptor activity
Specific Function: Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autorea...
Gene Name: IL2RA
Uniprot ID: P01589
Uniprot Name: Interleukin-2 receptor subunit alpha
Molecular Weight: 30818.915 Da

References

Shamsi TS, Irfan M, Farzana T, Ansari SH, Ahmad G, Shakoor N, Baig MI: Allogeneic peripheral blood stem cell transplant (PBSCT) using anti-IL2 receptor antibody Daclizumab for the prevention of acute graft versus host disease in steroid refractory Diamond Blackfan anaemia: a case report. J Pak Med Assoc. 2005 Oct;55(10):454-5. [Article]
Przepiorka D, Kernan NA, Ippoliti C, Papadopoulos EB, Giralt S, Khouri I, Lu JG, Gajewski J, Durett A, Cleary K, Champlin R, Andersson BS, Light S: Daclizumab, a humanized anti-interleukin-2 receptor alpha chain antibody, for treatment of acute graft-versus-host disease. Blood. 2000 Jan 1;95(1):83-9. [Article]
Garcia CD, Bittencourt VB, Tumelero A, Antonello JS, Malheiros D, Garcia VD: Plasmapheresis for recurrent posttransplant focal segmental glomerulosclerosis. Transplant Proc. 2006 Jul-Aug;38(6):1904-5. [Article]
Krouwels FH, van der Heijden JF, Lutter R, van Neerven RJ, Jansen HM, Out TA: Glucocorticosteroids affect functions of airway- and blood-derived human T-cell clones, favoring the Th1 profile through two mechanisms. Am J Respir Cell Mol Biol. 1996 Apr;14(4):388-97. [Article]
Patlolla V, Zhong X, Reed GW, Mandelbrot DA: Efficacy of anti-IL-2 receptor antibodies compared to no induction and to antilymphocyte antibodies in renal transplantation. Am J Transplant. 2007 Jul;7(7):1832-42. [Article]
Monti P, Brigatti C, Heninger AK, Scirpoli M, Bonifacio E: Disengaging the IL-2 receptor with daclizumab enhances IL-7-mediated proliferation of CD4(+) and CD8(+) T cells. Am J Transplant. 2009 Dec;9(12):2727-35. doi: 10.1111/j.1600-6143.2009.02825.x. Epub 2009 Sep 25. [Article]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]

Details2. Interleukin-2 receptor subunit beta

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Antibody

General Function: Interleukin-2 receptor activity
Specific Function: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Gene Name: IL2RB
Uniprot ID: P14784
Uniprot Name: Interleukin-2 receptor subunit beta
Molecular Weight: 61116.59 Da

References

Light JA, Sasaki TM, Ghasemian R, Barhyte DY, Fowlkes DL: Daclizumab induction/tacrolimus sparing: a randomized prospective trial in renal transplantation. Clin Transplant. 2002;16 Suppl 7:30-3. [Article]
Aguillon JC, Contreras J, Dotte A, Cruzat A, Catalan D, Salazar L, Molina MC, Guerrero J, Lopez M, Soto L, Salazar-Onfray F, Cuchacovich M: [New immunological weapons for medicine in the 21st Century: biological therapy based on the use of the latest generation monoclonal antibodies]. Rev Med Chil. 2003 Dec;131(12):1445-53. [Article]
Forrest K, Logan B, Strange J, Roszman TL, Goebel J: Daclizumab therapy in kidney transplantation-different mechanisms of action in- versus ex-vivo? Transpl Immunol. 2005 Mar;14(1):43-7. Epub 2005 Jan 4. [Article]
Ramos EL, Milford EL, Kirkman RL, Tilney NL, Strom TB, Shapiro ME, Waldmann TA, Wood IG, Rollins MR, Carpenter CB: Differential IL-2 receptor expression in renal allograft recipients treated with an anti-IL-2-receptor antibody. Transplantation. 1989 Sep;48(3):415-20. [Article]
Burkhardt K, Mandel TE, Diamantstein T, Loughnan MS: Anti-IL-2 receptor monoclonal antibody AMT-13 increases soluble IL-2 receptor levels in vivo. Immunology. 1989 Feb;66(2):183-9. [Article]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]

Details3. Low affinity immunoglobulin gamma Fc region receptor III-B

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name: FCGR3B
Uniprot ID: O75015
Uniprot Name: Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight: 26215.64 Da

References

Hoshino S, Oshimi K, Teramura M, Mizoguchi H: Activation via the CD3 and CD16 pathway mediates interleukin-2-dependent autocrine proliferation of granular lymphocytes in patients with granular lymphocyte proliferative disorders. Blood. 1991 Dec 15;78(12):3232-40. [Article]
Martelletti P, Stirparo G, De Stefano L, Di Sabato F, Giacovazzo M, Rinaldi-Garaci C: Defective expression of IL-2 receptors on peripheral blood lymphocytes from patients with cluster headache. Headache. 1990 Mar;30(4):228-31. [Article]
Galandrini R, Albi N, Tripodi G, Zarcone D, Terenzi A, Moretta A, Grossi CE, Velardi A: Antibodies to CD44 trigger effector functions of human T cell clones. J Immunol. 1993 May 15;150(10):4225-35. [Article]
Lanier LL, Kipps TJ, Phillips JH: Functional properties of a unique subset of cytotoxic CD3+ T lymphocytes that express Fc receptors for IgG (CD16/Leu-11 antigen). J Exp Med. 1985 Dec 1;162(6):2089-106. [Article]
Hayakawa K, Salmeron MA, Kornbluth J, Bucana C, Itoh K: The role of IL-4 in proliferation and differentiation of human natural killer cells. Study of an IL-4-dependent versus an IL-2-dependent natural killer cell clone. J Immunol. 1991 Apr 1;146(7):2453-60. [Article]

Details4. Complement C1r subcomponent

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Serine-type peptidase activity
Specific Function: C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name: C1R
Uniprot ID: P00736
Uniprot Name: Complement C1r subcomponent
Molecular Weight: 80118.04 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details5. Complement C1q subcomponent subunit A

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name: C1QA
Uniprot ID: P02745
Uniprot Name: Complement C1q subcomponent subunit A
Molecular Weight: 26016.47 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details6. Complement C1q subcomponent subunit B

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name: C1QB
Uniprot ID: P02746
Uniprot Name: Complement C1q subcomponent subunit B
Molecular Weight: 26721.62 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details7. Complement C1q subcomponent subunit C

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name: C1QC
Uniprot ID: P02747
Uniprot Name: Complement C1q subcomponent subunit C
Molecular Weight: 25773.56 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details8. Low affinity immunoglobulin gamma Fc region receptor III-A

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name: FCGR3A
Uniprot ID: P08637
Uniprot Name: Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight: 29088.895 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details9. High affinity immunoglobulin gamma Fc receptor I

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Receptor signaling protein activity
Specific Function: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name: FCGR1A
Uniprot ID: P12314
Uniprot Name: High affinity immunoglobulin gamma Fc receptor I
Molecular Weight: 42631.525 Da

References

Simms HH, Gaither TA, Fries LF, Frank MM: Monokines released during short-term Fc gamma receptor phagocytosis up-regulate polymorphonuclear leukocytes and monocyte-phagocytic function. J Immunol. 1991 Jul 1;147(1):265-72. [Article]

Details10. Low affinity immunoglobulin gamma Fc region receptor II-a

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name: FCGR2A
Uniprot ID: P12318
Uniprot Name: Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight: 35000.42 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details11. Low affinity immunoglobulin gamma Fc region receptor II-b

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Not Available
Specific Function: Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name: FCGR2B
Uniprot ID: P31994
Uniprot Name: Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight: 34043.355 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Details12. Low affinity immunoglobulin gamma Fc region receptor II-c

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Transmembrane signaling receptor activity
Specific Function: Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name: FCGR2C
Uniprot ID: P31995
Uniprot Name: Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight: 35577.96 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]

Drug created on June 13, 2005 13:24 / Updated on August 05, 2021 19:41

Daclizumab

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Pharmacoeconomics

Properties

Targets

References

References

References

References

References

References

References

References

References

References

References

References