Cyclic AMP-dependent transcription factor ATF-7

Details

Name
Cyclic AMP-dependent transcription factor ATF-7
Synonyms
  • Activating transcription factor 7
  • ATFA
  • cAMP-dependent transcription factor ATF-7
  • Transcription factor ATF-A
Gene Name
ATF7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008703|Cyclic AMP-dependent transcription factor ATF-7
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKN
CEEVGLFNELASSFEHEFKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEE
EPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSLPLHLGYDPLHPTL
PSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPGPPVQMPSVISLARPVSMVP
NIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTAR
PEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLERNRAAASRC
RQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQG
YLESPKESSEPTGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQ
SHVIMTPQSQSAGR
Number of residues
494
Molecular Weight
52966.875
Theoretical pI
Not Available
GO Classification
Functions
DNA binding / DNA binding transcription factor activity / enzyme binding / metal ion binding / mitogen-activated protein kinase binding / RNA polymerase II proximal promoter sequence-specific DNA binding / transcription factor binding / transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA binding
Processes
negative regulation of transcription from RNA polymerase II promoter / regulation of transcription, DNA-templated / transcription, DNA-templated / viral process
Components
cytoplasm / nuclear periphery / nucleoplasm / nucleus
General Function
Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family.
Specific Function
Dna binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0051556|Cyclic AMP-dependent transcription factor ATF-7 (ATF7)
ATGGGAGACGACAGACCGTTTGTGTGCAATGCCCCGGGCTGTGGACAGAGATTTACAAAC
GAGGACCACCTGGCAGTTCATAAACACAAGCATGAGATGACATTGAAATTTGGCCCAGCC
CGAACTGACTCAGTCATCATTGCAGATCAAACGCCTACTCCAACTAGATTCCTGAAGAAC
TGTGAGGAGGTGGGACTCTTCAATGAACTAGCTAGCTCCTTTGAACATGAATTCAAGAAA
GCTGCAGATGAGGATGAGAAAAAGGCTGCTGCTGGGCCCCTTGACATGTCTCTGCCTTCC
ACACCAGACATCAAAATCAAAGAAGAAGAGCCAGTGGAGGTAGACTCATCCCCACCTGAT
AGCCCTGCCTCTAGTCCCTGTTCCCCACCACTGAAGGAGAAGGAGGTTACCCCAAAGCCT
GTTCTGATCTCTACCCCCACACCCACCATTGTACGTCCTGGCTCCCTGCCTCTCCACTTG
GGCTATGATCCACTTCATCCAACCCTTCCCTCCCCAACCTCTGTCATCACACAGGCTCCA
CCATCCAACAGGCAAATGGGGTCTCCCACTGGCTCCCTCCCTCTTGTCATGCATCTTGCT
AATGGACAGACCATGCCTGTGTTGCCAGGGCCTCCAGTACAGATGCCGTCTGTTATATCG
CTGGCCAGACCTGTGTCCATGGTGCCCAACATTCCTGGTATCCCTGGCCCACCAGTTAAC
AGTAGTGGCTCCATTTCTCCCTCTGGCCACCCTATACCATCAGAAGCCAAGATGAGACTG
AAAGCCACCCTAACTCACCAAGTCTCCTCAATCAATGGTGGTTGTGGAATGGTGGTGGGT
ACTGCCAGCACCATGGTGACAGCCCGCCCAGAGCAGAGCCAGATTCTCATCCAGCACCCT
GATGCCCCATCCCCTGCCCAGCCACAGGTCTCACCAGCTCAGCCCACCCCTAGTACTGGG
GGGCGACGGCGGCGCACAGTAGATGAAGATCCAGATGAGCGACGGCAGCGCTTTCTGGAG
CGCAACCGGGCTGCAGCCTCCCGCTGCCGCCAAAAGCGAAAGCTGTGGGTGTCCTCCCTA
GAGAAGAAGGCCGAAGAACTCACTTCTCAGAACATTCAGCTGAGTAATGAAGTCACATTA
CTACGCAATGAGGTGGCCCAGTTGAAACAGCTACTGTTAGCTCATAAAGACTGCCCAGTC
ACTGCACTACAGAAAAAGACTCAAGGCTATTTAGAAAGCCCCAAGGAAAGCTCAGAGCCA
ACGGGTTCTCCAGCCCCTGTGATTCAGCACAGCTCAGCAACAGCCCCTAGCAATGGCCTC
AGTGTTCGCTCTGCAGCTGAAGCTGTGGCCACCTCGGTCCTCACTCAGATGGCCAGCCAA
AGGACAGAACTGAGCATGCCGATACAATCGCATGTAATCATGACCCCACAGTCCCAGTCT
GCGGGCAGATGA
Chromosome Location
12
Locus
12q13.13
External Identifiers
ResourceLink
UniProtKB IDP17544
UniProtKB Entry NameATF7_HUMAN
HGNC IDHGNC:792
General References
  1. Gaire M, Chatton B, Kedinger C: Isolation and characterization of two novel, closely related ATF cDNA clones from HeLa cells. Nucleic Acids Res. 1990 Jun 25;18(12):3467-73. [PubMed:1694576]
  2. Pescini R, Kaszubska W, Whelan J, DeLamarter JF, Hooft van Huijsduijnen R: ATF-a0, a novel variant of the ATF/CREB transcription factor family, forms a dominant transcription inhibitor in ATF-a heterodimers. J Biol Chem. 1994 Jan 14;269(2):1159-65. [PubMed:8288576]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Hai T, Curran T: Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity. Proc Natl Acad Sci U S A. 1991 May 1;88(9):3720-4. [PubMed:1827203]
  7. Chatton B, Bocco JL, Gaire M, Hauss C, Reimund B, Goetz J, Kedinger C: Transcriptional activation by the adenovirus larger E1a product is mediated by members of the cellular transcription factor ATF family which can directly associate with E1a. Mol Cell Biol. 1993 Jan;13(1):561-70. [PubMed:8417352]
  8. Chatton B, Bocco JL, Goetz J, Gaire M, Lutz Y, Kedinger C: Jun and Fos heterodimerize with ATFa, a member of the ATF/CREB family and modulate its transcriptional activity. Oncogene. 1994 Feb;9(2):375-85. [PubMed:8290251]
  9. De Graeve F, Bahr A, Sabapathy KT, Hauss C, Wagner EF, Kedinger C, Chatton B: Role of the ATFa/JNK2 complex in Jun activation. Oncogene. 1999 Jun 10;18(23):3491-500. [PubMed:10376527]
  10. Hamard PJ, Dalbies-Tran R, Hauss C, Davidson I, Kedinger C, Chatton B: A functional interaction between ATF7 and TAF12 that is modulated by TAF4. Oncogene. 2005 May 12;24(21):3472-83. [PubMed:15735663]
  11. Hamard PJ, Boyer-Guittaut M, Camuzeaux B, Dujardin D, Hauss C, Oelgeschlager T, Vigneron M, Kedinger C, Chatton B: Sumoylation delays the ATF7 transcription factor subcellular localization and inhibits its transcriptional activity. Nucleic Acids Res. 2007;35(4):1134-44. Epub 2007 Jan 30. [PubMed:17264123]
  12. Camuzeaux B, Diring J, Hamard PJ, Oulad-Abdelghani M, Donzeau M, Vigneron M, Kedinger C, Chatton B: p38beta2-mediated phosphorylation and sumoylation of ATF7 are mutually exclusive. J Mol Biol. 2008 Dec 26;384(4):980-91. doi: 10.1016/j.jmb.2008.10.008. Epub 2008 Oct 11. [PubMed:18950637]
  13. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  14. Diring J, Camuzeaux B, Donzeau M, Vigneron M, Rosa-Calatrava M, Kedinger C, Chatton B: A cytoplasmic negative regulator isoform of ATF7 impairs ATF7 and ATF2 phosphorylation and transcriptional activity. PLoS One. 2011;6(8):e23351. doi: 10.1371/journal.pone.0023351. Epub 2011 Aug 16. [PubMed:21858082]
  15. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  16. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  17. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00852PseudoephedrineapprovedunknowninhibitorDetails