Endothelin-1 receptor
Details
- Name
- Endothelin-1 receptor
- Synonyms
- Endothelin receptor type A
- ET-A
- ETA
- ETA-R
- ETRA
- hET-AR
- Gene Name
- EDNRA
- UniProtKB Entry
- P25101Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0001040|Endothelin-1 receptor METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS SHKDSMN
- Number of residues
- 427
- Molecular Weight
- 48721.76
- Theoretical pI
- 8.41
- GO Classification
- Processesadenylate cyclase-inhibiting G protein-coupled receptor signaling pathway / aorta development / atrial cardiac muscle tissue development / axon extension / axonogenesis involved in innervation / blood vessel remodeling / branching involved in blood vessel morphogenesis / calcium ion transmembrane transport / canonical Wnt signaling pathway / cardiac chamber formation / cardiac neural crest cell migration involved in outflow tract morphogenesis / cell population proliferation / cellular response to follicle-stimulating hormone stimulus / cellular response to human chorionic gonadotropin stimulus / cellular response to luteinizing hormone stimulus / cellular response to oxidative stress / cranial skeletal system development / developmental pigmentation / embryonic heart tube development / embryonic skeletal system development / endothelin receptor signaling pathway involved in heart process / establishment of endothelial barrier / face development / G protein-coupled receptor signaling pathway / gene expression / glomerular endothelium development / glomerular filtration / heparin metabolic process / intracellular calcium ion homeostasis / left ventricular cardiac muscle tissue morphogenesis / meiotic cell cycle process involved in oocyte maturation / mesenchymal cell apoptotic process / middle ear morphogenesis / mitochondrion organization / mitotic cell cycle / neural crest cell fate commitment / neuromuscular process / neuron remodeling / noradrenergic neuron differentiation / norepinephrine metabolic process / pharyngeal arch artery morphogenesis / phospholipase C-activating G protein-coupled receptor signaling pathway / podocyte apoptotic process / podocyte differentiation / positive regulation of canonical NF-kappaB signal transduction / positive regulation of cation channel activity / protein kinase A signaling / protein transmembrane transport / regulation of glucose transmembrane transport / regulation of heart rate / regulation of protein localization to cell leading edge / renal albumin absorption / renal sodium ion absorption / respiratory gaseous exchange by respiratory system / response to acetylcholine / response to amphetamine / response to wounding / semaphorin-plexin signaling pathway involved in axon guidance / sodium ion homeostasis / sympathetic nervous system development / sympathetic neuron axon guidance / thyroid gland development / vascular associated smooth muscle cell development
- General Function
- Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3
- Specific Function
- endothelin receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- 1-20
- Transmembrane Regions
- 81-102 113-132 160-181 206-229 257-278 307-328 348-372
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010366|Endothelin-1 receptor (EDNRA) ATGGAAACCCTTTGCCTCAGGGCATCCTTTTGGCTGGCACTGGTTGGATGTGTAATCAGT GATAATCCTGAGAGATACAGCACAAATCTAAGCAATCATGTGGATGATTTCACCACTTTT CGTGGCACAGAGCTCAGCTTCCTGGTTACCACTCATCAACCCACTAATTTGGTCCTACCC AGCAATGGCTCAATGCACAACTATTGCCCACAGCAGACTAAAATTACTTCAGCTTTCAAA TACATTAACACTGTGATATCTTGTACTATTTTCATCGTGGGAATGGTGGGGAATGCAACT CTGCTCAGGATCATTTACCAGAACAAATGTATGAGGAATGGCCCCAACGCGCTGATAGCC AGTCTTGCCCTTGGAGACCTTATCTATGTGGTCATTGATCTCCCTATCAATGTATTTAAG TTCTACCAAGATGTAAAGGACTGGTGGCTCTTCGGGTTCTATTTCTGTATGCCCTTGGTG TGCACTGCGATCTTCTACACCCTCATGACTTGTGAGATGTTGAACAGAAGGAATGGCAGC TTGAGAATTGCCCTCAGTGAACATCTTAAGCAGCGTCGAGAAGTGGCAAAAACAGTTTTC TGCTTGGTTGTAATTTTTGCTCTTTGCTGGTTCCCTCTTCATTTAAGCCGTATATTGAAG AAAACTGTGTATAACGAGATGGACAAGAACCGATGTGAATTACTTAGTTTCTTACTGCTC ATGGATTACATCGGTATTAACTTGGCAACCATGAATTCATGTATAAACCCCATAGCTCTG TATTTTGTGAGCAAGAAATTTAAAAATTGTTTCCAGTCATGCCTCTGCTGCTGCTGTTAC CAGTCCAAAAGTCTGATGACCTCGGTCCCCATGAACGGAACAAGCATCCAGTGGAAGAAC CACGATCAAAACAACCACAACACAGACCGGAGCAGCCATAAGGACAGCATGAACTGA
- Chromosome Location
- 4
- Locus
- 4q31.22-q31.23
- External Identifiers
Resource Link UniProtKB ID P25101 UniProtKB Entry Name EDNRA_HUMAN GenBank Protein ID 238636 GenBank Gene ID S63938 GeneCard ID EDNRA GenAtlas ID EDNRA HGNC ID HGNC:3179 PDB ID(s) 8HCQ KEGG ID hsa:1909 IUPHAR/Guide To Pharmacology ID 219 NCBI Gene ID 1909 - General References
- Adachi M, Yang YY, Furuichi Y, Miyamoto C: Cloning and characterization of cDNA encoding human A-type endothelin receptor. Biochem Biophys Res Commun. 1991 Nov 14;180(3):1265-72. [Article]
- Cyr C, Huebner K, Druck T, Kris R: Cloning and chromosomal localization of a human endothelin ETA receptor. Biochem Biophys Res Commun. 1991 Nov 27;181(1):184-90. [Article]
- Hosoda K, Nakao K, Hiroshi-Arai, Suga S, Ogawa Y, Mukoyama M, Shirakami G, Saito Y, Nakanishi S, Imura H: Cloning and expression of human endothelin-1 receptor cDNA. FEBS Lett. 1991 Aug 5;287(1-2):23-6. [Article]
- Arai H, Nakao K, Hosoda K, Ogawa Y, Nakagawa O, Komatsu Y, Imura H: [Molecular cloning of human endothelin receptors and their expression in vascular endothelial cells and smooth muscle cells]. Jpn Circ J. 1992;56 Suppl 5:1303-7. [Article]
- Elshourbagy NA, Korman DR, Wu HL, Sylvester DR, Lee JA, Nuthalaganti P, Bergsma DJ, Kumar CS, Nambi P: Molecular characterization and regulation of the human endothelin receptors. J Biol Chem. 1993 Feb 25;268(6):3873-9. [Article]
- Hosoda K, Nakao K, Tamura N, Arai H, Ogawa Y, Suga S, Nakanishi S, Imura H: Organization, structure, chromosomal assignment, and expression of the gene encoding the human endothelin-A receptor. J Biol Chem. 1992 Sep 15;267(26):18797-804. [Article]
- Hayzer DJ, Rose PM, Lynch JS, Webb ML, Kienzle BK, Liu EC, Bogosian EA, Brinson E, Runge MS: Cloning and expression of a human endothelin receptor: subtype A. Am J Med Sci. 1992 Oct;304(4):231-8. [Article]
- Miyamoto Y, Yoshimasa T, Arai H, Takaya K, Ogawa Y, Itoh H, Nakao K: Alternative RNA splicing of the human endothelin-A receptor generates multiple transcripts. Biochem J. 1996 Feb 1;313 ( Pt 3):795-801. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Yang H, Tabuchi H, Furuichi Y, Miyamoto C: Molecular characterization of the 5'-flanking region of human genomic ETA gene. Biochem Biophys Res Commun. 1993 Jan 29;190(2):332-9. [Article]
- Bourgeois C, Robert B, Rebourcet R, Mondon F, Mignot TM, Duc-Goiran P, Ferre F: Endothelin-1 and ETA receptor expression in vascular smooth muscle cells from human placenta: a new ETA receptor messenger ribonucleic acid is generated by alternative splicing of exon 3. J Clin Endocrinol Metab. 1997 Sep;82(9):3116-23. [Article]
- Lee HJ, Chun M, Kandror KV: Tip60 and HDAC7 interact with the endothelin receptor a and may be involved in downstream signaling. J Biol Chem. 2001 May 18;276(20):16597-600. Epub 2001 Mar 21. [Article]
- Gordon CT, Weaver KN, Zechi-Ceide RM, Madsen EC, Tavares AL, Oufadem M, Kurihara Y, Adameyko I, Picard A, Breton S, Pierrot S, Biosse-Duplan M, Voisin N, Masson C, Bole-Feysot C, Nitschke P, Delrue MA, Lacombe D, Guion-Almeida ML, Moura PP, Garib DG, Munnich A, Ernfors P, Hufnagel RB, Hopkin RJ, Kurihara H, Saal HM, Weaver DD, Katsanis N, Lyonnet S, Golzio C, Clouthier DE, Amiel J: Mutations in the endothelin receptor type A cause mandibulofacial dysostosis with alopecia. Am J Hum Genet. 2015 Apr 2;96(4):519-31. doi: 10.1016/j.ajhg.2015.01.015. Epub 2015 Mar 12. [Article]
- Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Endothelin-1 receptor (Humans) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Bosentan approved, investigational yes target antagonist Details Darusentan investigational yes target antagonist Details Sparsentan approved, investigational yes target antagonist Details SPP 301 investigational unknown target Details Actelion-1 investigational unknown target Details Ambrisentan approved, investigational yes target antagonist Details Atrasentan investigational yes target antagonist Details Tezosentan investigational unknown target Details 2-HYDROXY-3,5-DIIODOBENZOIC ACID experimental yes target inhibitor Details Sitaxentan approved, investigational, withdrawn yes target antagonist Details Macitentan approved yes target antagonist Details Acetylsalicylic acid approved, vet_approved unknown target inhibitor Details Clazosentan investigational yes target antagonist Details Enrasentan investigational yes target modulator Details Aprocitentan approved, investigational yes target antagonist Details Zibotentan investigational yes target antagonist Details TBC-3711 investigational yes target antagonist Details BQ-123 investigational yes target antagonist Details