30S ribosomal protein S15

Details

Name
30S ribosomal protein S15
Kind
protein
Synonyms
Not Available
Gene Name
rpsO
UniProtKB Entry
Q5SJ76Swiss-Prot
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
NCBI Taxonomy ID
300852
Amino acid sequence
>lcl|BSEQ0012925|30S ribosomal protein S15
MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMV
GQRRRLLRYLQREDPERYRALIEKLGIRG
Number of residues
89
Molecular Weight
10554.28
Theoretical pI
11.11
GO Classification
Functions
rRNA binding / structural constituent of ribosome
Processes
translation
Components
ribosome
General Function
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.
Specific Function
rRNA binding
Pfam Domain Function
Signal Regions
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012926|30S ribosomal protein S15 (rpsO)
ATGCCCATCACGAAGGAAGAGAAGCAGAAGGTCATCCAGGAGTTCGCCCGCTTCCCCGGG
GACACGGGGAGCACCGAGGTGCAGGTGGCGCTCCTTACCCTGAGGATCAACCGGCTTTCC
GAGCACCTCAAGGTCCACAAGAAGGACCACCACTCCCACCGCGGCCTCCTGATGATGGTG
GGCCAGCGCCGCAGGCTCCTCCGCTACCTCCAGCGGGAGGACCCCGAGCGGTACCGGGCC
CTTATTGAGAAGCTGGGCATCCGGGGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5SJ76
UniProtKB Entry NameRS15_THET8
GenBank Protein ID5053134
GenBank Gene IDL09121
PDB ID(s)1FJG, 1FKA, 1G1X, 1HNW, 1HNX, 1HNZ, 1HR0, 1I94, 1I95, 1I96, 1I97, 1IBK, 1IBL, 1IBM, 1J5E, 1JGO, 1JGP, 1JGQ, 1L1U, 1ML5, 1N32, 1N33, 1N34, 1N36, 1QD7, 1VVJ, 1VY4, 1VY5, 1VY6, 1VY7, 1XMO, 1XMQ, 1XNQ, 1XNR, 2E5L, 2F4V, 2HHH, 2UU9, 2UUA, 2UUB, 2UUC, 2UXB, 2UXC, 2UXD, 2VQE, 2VQF, 2ZM6, 3OTO, 3T1H, 3T1Y, 4AQY, 4B3M, 4B3R, 4B3S, 4B3T, 4DR1, 4DR2, 4DR3, 4DR4, 4DR5, 4DR6, 4DR7, 4DUY, 4DUZ, 4DV0, 4DV1, 4DV2, 4DV3, 4DV4, 4DV5, 4DV6, 4DV7, 4GKJ, 4GKK, 4JI0, 4JI1, 4JI2, 4JI3, 4JI4, 4JI5, 4JI6, 4JI7, 4JI8, 4JV5, 4JYA, 4K0K, 4KHP, 4L47, 4L71, 4LEL, 4LF4, 4LF5, 4LF6, 4LF7, 4LF8, 4LF9, 4LFA, 4LFB, 4LFC, 4LFZ, 4LNT, 4LSK, 4LT8, 4NXM, 4NXN, 4OX9, 4P6F, 4P70, 4TUA, 4TUB, 4TUC, 4TUD, 4TUE, 4V42, 4V4A, 4V4I, 4V4P, 4V4R, 4V4S, 4V4T, 4V4X, 4V4Y, 4V4Z, 4V51, 4V5A, 4V5C, 4V5D, 4V5E, 4V5F, 4V5G, 4V5J, 4V5K, 4V5L, 4V5M, 4V5N, 4V5P, 4V5Q, 4V5R, 4V5S, 4V5Z, 4V68, 4V6A, 4V6F, 4V6G, 4V7J, 4V7K, 4V7L, 4V7M, 4V7W, 4V7X, 4V7Y, 4V7Z, 4V87, 4V8A, 4V8B, 4V8C, 4V8D, 4V8E, 4V8F, 4V8G, 4V8H, 4V8I, 4V8J, 4V8N, 4V8O, 4V8Q, 4V8U, 4V8X, 4V90, 4V95, 4V97, 4V9A, 4V9B, 4V9H, 4V9I, 4V9R, 4V9S, 4W2E, 4W2F, 4W2G, 4W2H, 4W2I, 4W4G, 4WPO, 4WQ1, 4WQF, 4WQR, 4WQU, 4WQY, 4WR6, 4WRA, 4WRO, 4WSD, 4WSM, 4WT1, 4WT8, 4WU1, 4WZD, 4WZO, 4X62, 4X64, 4X65, 4X66, 4Y4O, 4Y4P, 4YHH, 4YPB, 4YZV, 4Z3Q, 4Z3R, 4Z3S, 4Z8C, 4ZER, 5A9Z, 5AA0, 5BR8, 5D8B
KEGG IDttj:TTHA1138
NCBI Gene ID3169463
General References
  1. Keightley JA, Zimmermann BH, Mather MW, Springer P, Pastuszyn A, Lawrence DM, Fee JA: Molecular genetic and protein chemical characterization of the cytochrome ba3 from Thermus thermophilus HB8. J Biol Chem. 1995 Sep 1;270(35):20345-58. [Article]
  2. Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
  3. Culver GM, Cate JH, Yusupova GZ, Yusupov MM, Noller HF: Identification of an RNA-protein bridge spanning the ribosomal subunit interface. Science. 1999 Sep 24;285(5436):2133-6. [Article]
  4. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
  5. Clemons WM Jr, May JL, Wimberly BT, McCutcheon JP, Capel MS, Ramakrishnan V: Structure of a bacterial 30S ribosomal subunit at 5.5 A resolution. Nature. 1999 Aug 26;400(6747):833-40. doi: 10.1038/23631. [Article]
  6. Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
  7. Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
  8. Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
  9. Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
  10. Agalarov SC, Sridhar Prasad G, Funke PM, Stout CD, Williamson JR: Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain. Science. 2000 Apr 7;288(5463):107-13. [Article]
  11. Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
  12. Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
  13. Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
  14. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
  15. Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
  16. Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
2-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATEexperimentalunknowntargetDetails